Recombinant Full Length Brucella Canis Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL34002BF |
Product Overview : | Recombinant Full Length Brucella canis Prolipoprotein diacylglyceryl transferase(lgt) Protein (A9M6J4) (1-281aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella canis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-281) |
Form : | Lyophilized powder |
AA Sequence : | MIETLLPASALAFPAIDPVIFRIGPLAVHWYGLGYVVGILFAWWYGKKLLRSHRLWANNQ PPMAPEALDDFVIWAALGVVLGGRIGYVLFYNFSYYISNPLAIPALWDGGMSFHGGILGT TLAMILFARSRGILVWSMFDTIAAGVPIGLGVVRVANFINSELWGRVSDVPWAVYFPNGG PLPRHPSQLYEAFLEGLVLFFVLFVLVWGARKLKQPGFVAGAFVTGYGLSRIAVEFFREP DAQIGYLFGGWLTMGMVLSVPMVLLGLWAMWRANRAAARNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; BCAN_A1565; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | A9M6J4 |
◆ Recombinant Proteins | ||
RPL8-4957H | Recombinant Human RPL8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCDC134-832R | Recombinant Rat CCDC134 Protein, His (Fc)-Avi-tagged | +Inquiry |
RANGAP1-7416M | Recombinant Mouse RANGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MST1R-4614H | Recombinant Human MST1R Protein (Met1-Leu571), C-His tagged | +Inquiry |
PBRM1-162H | Recombinant Human PBRM1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
Collagen-322H | Native Human Collagen IV | +Inquiry |
Peroxidase-32H | Active Native Horseradish Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
THG1L-1096HCL | Recombinant Human THG1L 293 Cell Lysate | +Inquiry |
SOX5-1558HCL | Recombinant Human SOX5 293 Cell Lysate | +Inquiry |
VCP-419HCL | Recombinant Human VCP 293 Cell Lysate | +Inquiry |
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
THPO-001HCL | Recombinant Human THPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket