Recombinant Full Length Brassica Napus Squalene Monooxygenase 1,2(Sqp1,2) Protein, His-Tagged
Cat.No. : | RFL7637BF |
Product Overview : | Recombinant Full Length Brassica napus Squalene monooxygenase 1,2(SQP1,2) Protein (O65726) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brassica napus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MDMAFVEVCLRMLLVFVLSWTIFHVNNRKKKKATKLADLATEERKEGGPDVIIVGAGVGG SALAYALAKDGRRVHVIERDMREPVRMMGEFMQPGGRLMLSKLGLQDCLEEIDAQKSTGI RLFKDGKETVACFPVDTNFPYEPSGRFFHNGRFVQRLRQKASSLPNVRLEEGTVRSLIEE KGVVKGVTYKNSSGEETTSFAPLTVVCDGCHSNLRRSLNDNNAEVTAYEIGYISRNCRLE QPDKLHLIMAKPSFAMLYQVSSTDVRCNFELLSKNLPSVSNGEMTSFVRNSIAPQVPLKL RKTFLKGLDEGSHIKITQAKRIPATLSRKKGVIVLGDAFNMRHPVIASGMMVLLSDILIL SRLLKPLGNLGDENKVSEVMKSFYALRKPMSATVNTLGNSFWQVLIASTDEAKEAMRQGC FDYLSSGGFRTSGLMALIGGMNPRPLSLFYHLFVISLSSIGQLLSPFPTPLRVWHSLRLL DLSLKMLVPHLKAEGIGQMLSPTNAAAYRKSYMAATVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SQP1 |
Synonyms | SQP1,2; Squalene monooxygenase 1,2; Squalene epoxidase 1,2; SE 1,2 |
UniProt ID | O65726 |
◆ Recombinant Proteins | ||
NCAPH2-16H | Recombinant Human NCAPH2 protein, MYC/DDK-tagged | +Inquiry |
KLK1-074H | Recombinant Human KLK1 Protein, His-tagged | +Inquiry |
NA-0351H | Recombinant Influenza A H1N1 (A/Auckland/606/2001) NA protein, His-tagged | +Inquiry |
SLC15A1-1209H | Recombinant Human SLC15A1 protein, His & T7-tagged | +Inquiry |
MYD88-1550H | Recombinant Human Myeloid Differentiation Primary Response Gene (88) | +Inquiry |
◆ Native Proteins | ||
ENO2-8235H | Native Human Brain Neuron Specific Enolase | +Inquiry |
Thrombin-23H | Active Native Human alpha-Thrombin | +Inquiry |
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCBP2-3952HCL | Recombinant Human NCBP2 293 Cell Lysate | +Inquiry |
PAK2-1276HCL | Recombinant Human PAK2 cell lysate | +Inquiry |
CUL1-7185HCL | Recombinant Human CUL1 293 Cell Lysate | +Inquiry |
MASP1-4461HCL | Recombinant Human MASP1 293 Cell Lysate | +Inquiry |
IL18RAP-1353CCL | Recombinant Cynomolgus IL18RAP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SQP1 Products
Required fields are marked with *
My Review for All SQP1 Products
Required fields are marked with *
0
Inquiry Basket