Recombinant Full Length Bradyrhizobium Japonicum Probable Ni/Fe-Hydrogenase B-Type Cytochrome Subunit(Hupc) Protein, His-Tagged
Cat.No. : | RFL10349BF |
Product Overview : | Recombinant Full Length Bradyrhizobium japonicum Probable Ni/Fe-hydrogenase B-type cytochrome subunit(hupC) Protein (P21960) (1-247aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bradyrhizobium diazoefficiens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-247) |
Form : | Lyophilized powder |
AA Sequence : | MMDAVAPASDAGPDLAAIAADASGERAVGRPTVYVYEAPVRICHWVNAFSIIVLMVTGYL IGTPLPTVAGEASDNFVMGYIRFAHFAAGQVLAVFFLTRILWAFVGNHHSRQIFYIPVHR KQFWKEVLHEIRWYAFLEREPKMYVGHNPLAQTAMFTGFTLFVAFMIVTGFALYSEGQGI DSWQHKLFGWVFAIWPNSQDVHTWHHLGMWALVVFVMVHIYAAVREDIMSRQSIISSMIS GERQFRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hupC |
Synonyms | hupC; bll6940; Probable Ni/Fe-hydrogenase B-type cytochrome subunit |
UniProt ID | P21960 |
◆ Recombinant Proteins | ||
RFL12580SF | Recombinant Full Length Saccharomyces Cerevisiae Phosphatidylglycerol Phospholipase C(Pgc1) Protein, His-Tagged | +Inquiry |
Itpkc-3621M | Recombinant Mouse Itpkc Protein, Myc/DDK-tagged | +Inquiry |
ARPC3-2793H | Recombinant Human ARPC3 Protein, MYC/DDK-tagged | +Inquiry |
EPCAM-078H | Recombinant Human EPCAM Protein, Gln24-Lys245, C-His-Avi tagged, Biotinylated | +Inquiry |
MVB12BA-4500Z | Recombinant Zebrafish MVB12BA | +Inquiry |
◆ Native Proteins | ||
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
HBA2-27784TH | Native Human HBA2 | +Inquiry |
Lectin-1794A | Active Native Artocarpus integrifolia Jacalin Protein, Fluorescein labeled | +Inquiry |
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
Blood-011H | Human Blood Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMNDC1-1658HCL | Recombinant Human SMNDC1 293 Cell Lysate | +Inquiry |
IQCC-5180HCL | Recombinant Human IQCC 293 Cell Lysate | +Inquiry |
ESYT1-6535HCL | Recombinant Human ESYT1 293 Cell Lysate | +Inquiry |
MPP7-4228HCL | Recombinant Human MPP7 293 Cell Lysate | +Inquiry |
PRKCSH-2853HCL | Recombinant Human PRKCSH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hupC Products
Required fields are marked with *
My Review for All hupC Products
Required fields are marked with *
0
Inquiry Basket