Recombinant Full Length Bradyrhizobium Japonicum C4-Dicarboxylate Transport Protein 4(Dcta4) Protein, His-Tagged
Cat.No. : | RFL16364BF |
Product Overview : | Recombinant Full Length Bradyrhizobium japonicum C4-dicarboxylate transport protein 4(dctA4) Protein (Q89EA0) (1-442aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bradyrhizobium diazoefficiens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-442) |
Form : | Lyophilized powder |
AA Sequence : | MTQIAIQPAIRRRHQPWYKILYVQVLIAIVLGVLIGYFYPDFGKELKPLGDGFIALIKMM IAPVIFCTVVHGISSMGDLKRVGRVGLKSLIYFESVSTVALAVGLLVGEVLQPGHGFNID PATIDPKSVATYVTKAKEEGIVAHLMAIIPDSYVGAIARGDLLQVLLISILSGFAIAFLG KAGEPIADAIDKAAKMFFGIIRIIVRVAPVGAFGAMAFTVGAYGLGSLLNLAALIGTFYL TSILFVLIVLGAIARLAGFSILRFIAYIKDELLIVLGTSSSETVLPQMIQKMEHLGASRS VVGLVIPTGYSFNLDGTNIYMTLATLFLAQATNTHLTIWQELGILGIAMITSKGASGVTG AGFITLAATLSIVPDIPIQSIAILVGIDKFMSECRALTNLIGNGVACVVISISEGELDRD ALHETMAHPLEIGEALEPGGGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dctA4 |
Synonyms | dctA4; blr7187; C4-dicarboxylate transport protein 4 |
UniProt ID | Q89EA0 |
◆ Recombinant Proteins | ||
EGFR-077H | Recombinant Human EGFR Protein, DYKDDDDK-tagged | +Inquiry |
DAB2-2520HF | Recombinant Full Length Human DAB2 Protein, GST-tagged | +Inquiry |
RFL34040HF | Recombinant Full Length Sensory Rhodopsin(Sop) Protein, His-Tagged | +Inquiry |
OR6M1-3231R | Recombinant Rhesus monkey OR6M1 Protein, His-tagged | +Inquiry |
TGOLN2-5184H | Recombinant Human TGOLN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Proteasome 19S-39H | Native Human Proteasome 19S Protein, Tag Free | +Inquiry |
FGB-59R | Native Rabbit Fibrinogen | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
AMY2-5364P | Native Pig Amylase, Alpha 2B (pancreatic) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATAD2-8636HCL | Recombinant Human ATAD2 293 Cell Lysate | +Inquiry |
EXOSC8-6498HCL | Recombinant Human EXOSC8 293 Cell Lysate | +Inquiry |
WDFY1-359HCL | Recombinant Human WDFY1 293 Cell Lysate | +Inquiry |
LYZL1-4579HCL | Recombinant Human LYZL1 293 Cell Lysate | +Inquiry |
RPL12-2227HCL | Recombinant Human RPL12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dctA4 Products
Required fields are marked with *
My Review for All dctA4 Products
Required fields are marked with *
0
Inquiry Basket