Recombinant Full Length Bovine Transmembrane Protein 11, Mitochondrial(Tmem11) Protein, His-Tagged
Cat.No. : | RFL35713BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein 11, mitochondrial(TMEM11) Protein (A5D7N3) (1-192aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-192) |
Form : | Lyophilized powder |
AA Sequence : | MAAWGRRRLGPGSGGGGARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYI VIEPTRIGDETARWITVGNCLHKTTVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCT LYGISWQFDPCCKYQVEYDAYRLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALV YCVKKIYELCAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM11 |
Synonyms | TMEM11; Transmembrane protein 11, mitochondrial |
UniProt ID | A5D7N3 |
◆ Recombinant Proteins | ||
Tmem11-6468M | Recombinant Mouse Tmem11 Protein, Myc/DDK-tagged | +Inquiry |
TMEM11-6111R | Recombinant Rat TMEM11 Protein | +Inquiry |
RFL9842DF | Recombinant Full Length Danio Rerio Transmembrane Protein 11, Mitochondrial(Tmem11) Protein, His-Tagged | +Inquiry |
TMEM11-4457H | Recombinant Human TMEM11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMEM11-294H | Recombinant Human TMEM11 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM11-1013HCL | Recombinant Human TMEM11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM11 Products
Required fields are marked with *
My Review for All TMEM11 Products
Required fields are marked with *
0
Inquiry Basket