Recombinant Full Length Bovine Sideroflexin-3(Sfxn3) Protein, His-Tagged
Cat.No. : | RFL35753BF |
Product Overview : | Recombinant Full Length Bovine Sideroflexin-3(SFXN3) Protein (A6QP55) (1-321aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-321) |
Form : | Lyophilized powder |
AA Sequence : | MGELPLDINIQEPRWDQRTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGIVTP GLTEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLIFYRKTPTVVFWQ WLNQSFNAVVNYSNRSGDAPITVRQLGMAYVSATTGAVATALGLKSLTKHLPPLVGRFVP FAAVAAANCINIPLMRQRELQVGIPVTNEQGQRLGHSVAAAKKGIFQVVISRICMAIPAM AIPPVIMDTLEKKDFLKRRPWLGAPLQMGLVGFCLVFATPLCCALFPQRSSIHVSRLEPE LRAQIQEQNPSIEVVYYNKGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SFXN3 |
Synonyms | SFXN3; Sideroflexin-3 |
UniProt ID | A6QP55 |
◆ Recombinant Proteins | ||
SFXN3-15025M | Recombinant Mouse SFXN3 Protein | +Inquiry |
SFXN3-5361R | Recombinant Rat SFXN3 Protein | +Inquiry |
Sfxn3-5819M | Recombinant Mouse Sfxn3 Protein, Myc/DDK-tagged | +Inquiry |
SFXN3-1008H | Recombinant Human SFXN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL25737RF | Recombinant Full Length Rat Sideroflexin-3(Sfxn3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFXN3-1893HCL | Recombinant Human SFXN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFXN3 Products
Required fields are marked with *
My Review for All SFXN3 Products
Required fields are marked with *
0
Inquiry Basket