Recombinant Full Length Bovine Regulator Of Microtubule Dynamics Protein 3(Fam82A2) Protein, His-Tagged
Cat.No. : | RFL6286BF |
Product Overview : | Recombinant Full Length Bovine Regulator of microtubule dynamics protein 3(FAM82A2) Protein (Q1JQC5) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MSSLGTLGGARAGLGLLLGTAAGLGFLCALYSQRWKRTQRRGQSQSQSNSLDYTQTSEPG RQVRPLRAAPGEAGDAAVLSSLPRGQEVVLDRLEFVLTSLVALRREVEELRSSLQGLAGQ IVGEVRSHMEENQKVARRRRFPFARERSDSTGSSSVYFTAASGATFTDAESEGGYTTANA ESDYERDSERESDGDGEDEVSCETVKMGRKDSLDLEVEVALGLEPEAPEAGGSPGQEDVM PLLQQADELHQGSEQGKREGFQLLLNNKLVHGSRQDFLWRLARAYSDMCELTEEASEKRS YALSGKEEAEVALEKGNENAECHQWYAVLCGQLAEHEGIQRRIQSGFSFKEHVDKAIALK PENPMAHFLLGRWCYQVSHLSWLEKKTATALSESPLGATVQDALSSFLKAEELQPGFSKA GRIYICKCYKELGKNPEAKEWMKLALELPNVTKEDSAFQKDLEELEVILGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RMDN3 |
Synonyms | RMDN3; FAM82A2; FAM82C; Regulator of microtubule dynamics protein 3; RMD-3; Protein FAM82A2; Protein FAM82C |
UniProt ID | Q1JQC5 |
◆ Recombinant Proteins | ||
CLDN10-2038HF | Recombinant Full Length Human CLDN10 Protein, GST-tagged | +Inquiry |
RFL32510HF | Recombinant Full Length Human Olfactory Receptor 5M9(Or5M9) Protein, His-Tagged | +Inquiry |
ZC3H18-6310R | Recombinant Rat ZC3H18 Protein, His (Fc)-Avi-tagged | +Inquiry |
EZH2-1826H | Recombinant Human EZH2 protein, GST-tagged | +Inquiry |
SUMO3-251H | Recombinant Human SUMO3, His-tagged | +Inquiry |
◆ Native Proteins | ||
C5-53H | Native Human Complement C5 | +Inquiry |
Adipose Tissue-001H | Human Adipose Tissue Lysate, Total Protein | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR72-337HCL | Recombinant Human WDR72 293 Cell Lysate | +Inquiry |
CILP-7494HCL | Recombinant Human CILP 293 Cell Lysate | +Inquiry |
CDC27-7662HCL | Recombinant Human CDC27 293 Cell Lysate | +Inquiry |
GALNTL2-6032HCL | Recombinant Human GALNTL2 293 Cell Lysate | +Inquiry |
Diaphragm-104C | Cynomolgus monkey Diaphragm Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RMDN3 Products
Required fields are marked with *
My Review for All RMDN3 Products
Required fields are marked with *
0
Inquiry Basket