Recombinant Full Length Bovine Protein Rrnad1(Rrnad1) Protein, His-Tagged
Cat.No. : | RFL12827BF |
Product Overview : | Recombinant Full Length Bovine Protein RRNAD1(RRNAD1) Protein (Q5E9V4) (1-475aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-475) |
Form : | Lyophilized powder |
AA Sequence : | MPGVSARRLSHEERRQLAVNLTRVVTLYRSILDAYIIEFFTDNLWGTLPCSWQEALDGLN PPQLATLLLGMPREGEVARYRSVWPLTLLALKSTAYALAFTRTPGFQTPSEFLENPSQSS RLTAPFRKHVRPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSRFMSLGLGLMVK SIEGDQRLVERAQRLDQELLQTLEKEEKRNPKVVQTGPRHPPHHVVRWVDPTTLCEELLL PLETSPQSRARLLLTGLHACGDLSVALLKHFCCCPEVVALASVGCCYMKLSDPGGYPLSQ WVAGLPGYELPYRLREGACHALEEYAERLQKAGPSLRTHCYRAALETVIRCAQPELRRPG VQGIPRVHELKIEEYVQRGLQRVGLDPHLPLNVAALRAHQAQENRVVAFFSLALLLAPLV ETLILLDRLLYLQEQGFHAELLPIFSPELSPRNLVLVATKGPLGEAFSLLETEDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RRNAD1 |
Synonyms | METTL25B; RRNAD1; Methyltransferase-like protein 25B; Protein RRNAD1 |
UniProt ID | Q5E9V4 |
◆ Recombinant Proteins | ||
Ltbr-1219M | Active Recombinant Mouse Ltbr Protein, Fc-tagged | +Inquiry |
LIN28B-7186H | Recombinant Human Lin-28 Homolog B (C. elegans), His-tagged | +Inquiry |
YWOC-2177B | Recombinant Bacillus subtilis YWOC protein, His-tagged | +Inquiry |
MTND-1714B | Recombinant Bacillus subtilis MTND protein, His-tagged | +Inquiry |
S-534S | Recombinant SARS-CoV-2 (2019-nCoV) Spike RBD(V395I) Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
gp125-261V | Native EBV Viral Capsid gp125 Protein | +Inquiry |
FGA-5H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
ASO-153H | Active Native Human Antistreptolysin O | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECH1-6730HCL | Recombinant Human ECH1 293 Cell Lysate | +Inquiry |
KDM8-5102HCL | Recombinant Human JMJD5 293 Cell Lysate | +Inquiry |
PDIK1L-475HCL | Recombinant Human PDIK1L lysate | +Inquiry |
PDSS2-3319HCL | Recombinant Human PDSS2 293 Cell Lysate | +Inquiry |
ZNF254-2046HCL | Recombinant Human ZNF254 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRNAD1 Products
Required fields are marked with *
My Review for All RRNAD1 Products
Required fields are marked with *
0
Inquiry Basket