Recombinant Full Length Bovine Protein Fam210A(Fam210A) Protein, His-Tagged
Cat.No. : | RFL24261BF |
Product Overview : | Recombinant Full Length Bovine Protein FAM210A(FAM210A) Protein (Q05B67) (1-273aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-273) |
Form : | Lyophilized powder |
AA Sequence : | MQWNVPKTVFRLAHRTCMEPHKAGLLGHCQNMKGPLLLYTLESRVVVVQGPQKRWLHLPT AQCVAKERKPFTAVQSQPGVFHHKQWEQDILSKRVLSSSATSSGPPSEKKEDPDPLQDRS ISLYQRFKKTFRQYGKVLIPVHLITSAVWFGTFYYAAMKGVNVVPFLELIGLPDSIVNIL KNSQSGNALTAYALFKIATPARYTVTLGGTSFTVKYLRSRGYMSTPPPVKEYLQDKMEET KELLTEKMEETKDRLTEKLQETKGKVSLKKKVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAM210A |
Synonyms | FAM210A; Protein FAM210A |
UniProt ID | Q05B67 |
◆ Recombinant Proteins | ||
FAM210A-1890R | Recombinant Rat FAM210A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM210A-2126Z | Recombinant Zebrafish FAM210A | +Inquiry |
RFL22473GF | Recombinant Full Length Chicken Protein Fam210A(Fam210A) Protein, His-Tagged | +Inquiry |
RFL1586HF | Recombinant Full Length Human Protein Fam210A(Fam210A) Protein, His-Tagged | +Inquiry |
FAM210A-1604R | Recombinant Rhesus monkey FAM210A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM210A-8222HCL | Recombinant Human C18orf19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM210A Products
Required fields are marked with *
My Review for All FAM210A Products
Required fields are marked with *
0
Inquiry Basket