Recombinant Full Length Bovine Pra1 Family Protein 3(Arl6Ip5) Protein, His-Tagged
Cat.No. : | RFL420BF |
Product Overview : | Recombinant Full Length Bovine PRA1 family protein 3(ARL6IP5) Protein (Q5E9M1) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-188) |
Form : | Lyophilized powder |
AA Sequence : | MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISLFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEEIGLKRTPMGIVLDALEQQEETITKFS DYISKMKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARL6IP5 |
Synonyms | ARL6IP5; PRAF3; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5 |
UniProt ID | Q5E9M1 |
◆ Recombinant Proteins | ||
PARR-1876S | Recombinant Staphylococcus aureus PARR protein, His-tagged | +Inquiry |
RFL9298OF | Recombinant Full Length Oltmannsiellopsis Viridis Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged | +Inquiry |
HTR5B-2624R | Recombinant Rat HTR5B Protein, His (Fc)-Avi-tagged | +Inquiry |
FSTL1-4525H | Recombinant Human FSTL1 Protein, GST-tagged | +Inquiry |
PI4K2B-2827C | Recombinant Chicken PI4K2B | +Inquiry |
◆ Native Proteins | ||
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
PLG-30083TH | Native Human PLG | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DU145-059WCY | Human Prostate Carcinoma DU145 Whole Cell Lysate | +Inquiry |
RELT-2418HCL | Recombinant Human RELT cell lysate | +Inquiry |
ALOX15-8897HCL | Recombinant Human ALOX15 293 Cell Lysate | +Inquiry |
CCDC28B-7767HCL | Recombinant Human CCDC28B 293 Cell Lysate | +Inquiry |
MAP2K7-4508HCL | Recombinant Human MAP2K7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL6IP5 Products
Required fields are marked with *
My Review for All ARL6IP5 Products
Required fields are marked with *
0
Inquiry Basket