Recombinant Full Length Bovine Metaxin-1(Mtx1) Protein, His-Tagged
Cat.No. : | RFL7651BF |
Product Overview : | Recombinant Full Length Bovine Metaxin-1(MTX1) Protein (Q2TBS1) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MAAPMELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKITNPWRSPSGTLPALRTSH GEVISVPHRIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLKHTFWIDAKNYV EVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLLCGEHRPEDEEELEKELYQEAQECLTL LSQRLGSQKFFFGDAPASLDAFVFSYLALLQQAKLPSGKLQAHLRGLHNLCAYCAHILSL YFPWEGAKAPPPRQTPANPETEEEPYRRRNQILTVLAGLAAMAGYALLSGIVSIQRAPSA RAPGTQALGMAEEDEEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTX1 |
Synonyms | MTX1; Metaxin-1; Mitochondrial outer membrane import complex protein 1 |
UniProt ID | Q2TBS1 |
◆ Recombinant Proteins | ||
RELA-611H | Recombinant Human RELA protein, His & T7-tagged | +Inquiry |
Hspb2-3453M | Recombinant Mouse Hspb2 Protein, Myc/DDK-tagged | +Inquiry |
CKBB-9496Z | Recombinant Zebrafish CKBB | +Inquiry |
YQJL-2968B | Recombinant Bacillus subtilis YQJL protein, His-tagged | +Inquiry |
FUCA2-4545H | Recombinant Human FUCA2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
PGC-8318H | Native Human PGC | +Inquiry |
ALB-524H | Native Human ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF383-2020HCL | Recombinant Human ZNF383 cell lysate | +Inquiry |
KBTBD4-5083HCL | Recombinant Human KBTBD4 293 Cell Lysate | +Inquiry |
MRPL20-4189HCL | Recombinant Human MRPL20 293 Cell Lysate | +Inquiry |
PPP1R8-2931HCL | Recombinant Human PPP1R8 293 Cell Lysate | +Inquiry |
PRSS12-1422HCL | Recombinant Human PRSS12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MTX1 Products
Required fields are marked with *
My Review for All MTX1 Products
Required fields are marked with *
0
Inquiry Basket