Recombinant Full Length Bovine Long-Wave-Sensitive Opsin 1(Opn1Lw) Protein, His-Tagged
Cat.No. : | RFL22560BF |
Product Overview : | Recombinant Full Length Bovine Long-wave-sensitive opsin 1(OPN1LW) Protein (Q9BGI7) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MAHAWGPQRLAGGQPQANFEESTQGSIFTYTNSNSTRDPFEGPNYHIAPRWVYHLTSAWM VFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAIADLAETIIASTISVVNQMYGYFV LGHPLCVVEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAITGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCFIPLSVIILCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAYCLCWGPYTFFACFAAAHPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDSSELSSVSKTEASSVSS VSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OPN1LW |
Synonyms | OPN1LW; RCP; Long-wave-sensitive opsin 1; Red cone photoreceptor pigment; Red-sensitive opsin |
UniProt ID | Q9BGI7 |
◆ Recombinant Proteins | ||
SMPD3-5625R | Recombinant Rat SMPD3 Protein | +Inquiry |
CCNDBP1-0663H | Recombinant Human CCNDBP1 Protein, GST-Tagged | +Inquiry |
hydrolase-5643A | Recombinant Aspergillus tubingensis Epoxide hydrolase, His-tagged | +Inquiry |
RFL23551SF | Recombinant Full Length Staphylococcus Aureus Upf0365 Protein Sausa300_1533(Sausa300_1533) Protein, His-Tagged | +Inquiry |
HPRT1-948H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
F10-26946TH | Native Human F10 | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C16orf58-8250HCL | Recombinant Human C16orf58 293 Cell Lysate | +Inquiry |
SEMA3C-1980HCL | Recombinant Human SEMA3C 293 Cell Lysate | +Inquiry |
SPEG-1680HCL | Recombinant Human SPEG cell lysate | +Inquiry |
SPINK2-1510HCL | Recombinant Human SPINK2 293 Cell Lysate | +Inquiry |
CRP-1945RCL | Recombinant Rat CRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPN1LW Products
Required fields are marked with *
My Review for All OPN1LW Products
Required fields are marked with *
0
Inquiry Basket