Recombinant Full Length Bovine Keratinocyte-Associated Protein 3(Krtcap3) Protein, His-Tagged
Cat.No. : | RFL35747BF |
Product Overview : | Recombinant Full Length Bovine Keratinocyte-associated protein 3(KRTCAP3) Protein (Q3SZ72) (1-240aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-240) |
Form : | Lyophilized powder |
AA Sequence : | MRCRRLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTT ANVISVGSGLLSVSLGLVALLASRNLFRPRLHWALLALALVNLLLSAACSLGLLLAVSLT VANGGRRLIADCHPGLLDPLVPLDQGSGHADCPFDPTKIYDTALALWIPSVFMSAAEAAL SGYCCVAALTLRGVGPCRKDGLQEQLEELTELEFPKRKWQENVQLLDQTREIRTSQKSWV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KRTCAP3 |
Synonyms | KRTCAP3; Keratinocyte-associated protein 3; KCP-3 |
UniProt ID | Q3SZ72 |
◆ Recombinant Proteins | ||
TPM2-31627TH | Recombinant Human TPM2 | +Inquiry |
Hdac9-3371M | Recombinant Mouse Hdac9 Protein, Myc/DDK-tagged | +Inquiry |
TNFRSF4-3246HAF555 | Recombinant Human TNFRSF4 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TMEM100-4571R | Recombinant Rhesus Macaque TMEM100 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBALD1-3659H | Recombinant Human UBALD1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf56-8100HCL | Recombinant Human C21orf56 293 Cell Lysate | +Inquiry |
TM2D3-1037HCL | Recombinant Human TM2D3 293 Cell Lysate | +Inquiry |
REG4-001HCL | Recombinant Human REG4 cell lysate | +Inquiry |
Kidney-99M | Mouse Kidney Tissue Lysate | +Inquiry |
SRBD1-1689HCL | Recombinant Human SRBD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRTCAP3 Products
Required fields are marked with *
My Review for All KRTCAP3 Products
Required fields are marked with *
0
Inquiry Basket