Recombinant Full Length Bovine Herpesvirus 1.2 Glycoprotein Gx Protein, His-Tagged
Cat.No. : | RFL859BF |
Product Overview : | Recombinant Full Length Bovine herpesvirus 1.2 Glycoprotein GX Protein (Q08103) (25-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BoHV-1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-444) |
Form : | Lyophilized powder |
AA Sequence : | RPAPDDLCFADVRRTGMAPSRPLGPVLNLAASDLTSRVSVRAVDASRGCALALLDMAETV VPGGPRAADVVDVGWAYQDGDCMVPLAYRQYFNCTGGALPGQNVCAGLSETRIRGGFGTS DYALYGTSLVLRPGLYDRGTYIYFLGYGPDDIYVGSVTLMVGADIHKYPCGLDRGLGVAL HHKSGPARPLTEDDATGDWACGCFPAVVEVDVVWGNVSAAELGLADPIDYADEGGEVEVL EDEAGSASGNLPQDDPDPDLADCRTVGLFSESDMFRTARGPESLLIGAVAKDVLTVPLNL PPGRSYEALRNASLECNSRPRETGDAAVVVMSLQEPARLERRPDARATDPEFGLFGLPDD PAVRRGILIGLAIALLVLLFSLVIVLVCACRLARAAKAARRARAATFAKSNPAYEPMLRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bovine herpesvirus 1.2 Glycoprotein GX |
Synonyms | Glycoprotein GX |
UniProt ID | Q08103 |
◆ Recombinant Proteins | ||
NLK1-12205Z | Recombinant Zebrafish NLK1 | +Inquiry |
AAR2-1305H | Recombinant Human AAR2 | +Inquiry |
Ubiquitin-14HFL | Recombinant Full Length Human Ubiquitin Protein, Vinyl Methyl Ester Labeled | +Inquiry |
IL2RB-5195H | Recombinant Human IL2RB Protein | +Inquiry |
PHKG1-478H | Recombinant Human PHKG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
INS-512D | Native Bovine INS | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
ApoA4-68H | Native Human Apolipoprotein AIV | +Inquiry |
DNA-005C | Native Calf DNA | +Inquiry |
◆ Cell & Tissue Lysates | ||
COLEC12-403RCL | Recombinant Rat COLEC12 cell lysate | +Inquiry |
SULT4A1-1347HCL | Recombinant Human SULT4A1 293 Cell Lysate | +Inquiry |
DUSP10-6784HCL | Recombinant Human DUSP10 293 Cell Lysate | +Inquiry |
RCN3-1282HCL | Recombinant Human RCN3 cell lysate | +Inquiry |
PC-12-2144R | PC-12 (rat adrenal gland pheochromocytoma) whole cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bovine herpesvirus 1.2 Glycoprotein GX Products
Required fields are marked with *
My Review for All Bovine herpesvirus 1.2 Glycoprotein GX Products
Required fields are marked with *
0
Inquiry Basket