Recombinant Full Length Bovine 3-Hydroxyacyl-Coa Dehydratase 3(Ptplad1) Protein, His-Tagged
Cat.No. : | RFL29511BF |
Product Overview : | Recombinant Full Length Bovine 3-hydroxyacyl-CoA dehydratase 3(PTPLAD1) Protein (A7YY55) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MENQVLTPHVYWAQRHHELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPVYKLTQRQVNITVQKKESQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEEQLNKLRLESQGSPETLTSLKKGYLFMYNLVQFLGFSWIFVNMTVRFFILGKESF YDTFHTVADMMYFCQMLAAVESINAAIGVTKSPVVPSLFQLLGRNFILFIIFGTMEEMQN KAVVFFVFYIWSTVEIFRYPFYMLSCIDMDWKVLTWLRYTVWIPLYPMGCLAEAVSVIQS IPVFNETGRFSFTLPYPVKIKVRFSFFLQIYLILLFLGLYVNFRYLYKQRRRRFGQKKKK IH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HACD3 |
Synonyms | HACD3; PTPLAD1; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 3; 3-hydroxyacyl-CoA dehydratase 3; HACD3; Protein-tyrosine phosphatase-like A domain-containing protein 1 |
UniProt ID | A7YY55 |
◆ Recombinant Proteins | ||
Cd70-8730RF | Recombinant Rat Cd70 Protein, Fc-tagged, FITC conjugated | +Inquiry |
WTAP-10212M | Recombinant Mouse WTAP Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18658RF | Recombinant Full Length Rat Surfeit Locus Protein 1(Surf1) Protein, His-Tagged | +Inquiry |
FDX1L-5806M | Recombinant Mouse FDX1L Protein | +Inquiry |
CSTF2-676H | Recombinant Human CSTF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
LDH-216S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFB2M-1135HCL | Recombinant Human TFB2M 293 Cell Lysate | +Inquiry |
Seminal-625R | Rat Seminal Vesicles Lysate, Total Protein | +Inquiry |
KSR2-963HCL | Recombinant Human KSR2 cell lysate | +Inquiry |
Adrenal-631B | Bovine Cortex Lysate, Total Protein | +Inquiry |
PDCD1-2873HCL | Recombinant Human PDCD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HACD3 Products
Required fields are marked with *
My Review for All HACD3 Products
Required fields are marked with *
0
Inquiry Basket