Recombinant Full Length Bos Indicus Toll-Like Receptor 2(Tlr2) Protein, His-Tagged
Cat.No. : | RFL13548BF |
Product Overview : | Recombinant Full Length Bos indicus Toll-like receptor 2(TLR2) Protein (B5T267) (21-784aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bos indicus (Zebu) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (21-784) |
Form : | Lyophilized powder |
AA Sequence : | ASDQASSLSCDPTGVCDGHSRSLNSIPSGLTAGVKSLDLSNNEITYVSNRDLQRCVNLKTLRLGANEIHTVEEDSFFHLRNLEYLDLSYNRLSNLSSSWFRSLYVLKFLNLLGNLYKTLGETSLFSHLPNLRTLKVGNSNSFTEIHEKDFTGLTFLEELEISAQNLQIYVPKSLKSIQNISHLILHLKQPVLLVDILVDIVSSLDCLELRDTNLHTFHFSEASISEMSTSVKKLIFRNVQFTDESFVEVVKLFNYVSGILEVEFDDCTHDGIGDFRALSLDRIRHLGNVETLTIRKLHIPQFFLFQDLSSIYPLTGKVKRVTIENSKVFLVPCLLSQHLKSLEYLDLSENLMSEETLKNSACKDAWPFLQTLVLRQNRLKSLEKXGELLLTLENLNSLDISKNNFLSMPETCQWPGKMKQLNLSSTRIHSLTQCLPQTLEILDVSNNNLDSFSLILPQLKELYISRNKLKTLPDASFLPVLXVMRISRNIINTFSKEQLDSFQQLKTLEAGGNNFICSCDFLSFTQGQQALGRVLVDWPDDYHCDSPSHVRGQRVQDARLSLSECHRAAVVSAACCALFLLLLLMGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPRRDICYDAFVSYSERDSYWVENLMVQELEQFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTIFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIDKKAIPQRFCKLRKIMNTKTYLEWPVDETQQEGFWLNLRAAIRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TLR2 |
Synonyms | TLR2; Toll-like receptor 2; CD antigen CD282 |
UniProt ID | B5T267 |
◆ Recombinant Proteins | ||
RFL24172CF | Recombinant Full Length Capra Ibex Toll-Like Receptor 2(Tlr2) Protein, His-Tagged | +Inquiry |
TLR2-12078Z | Recombinant Zebrafish TLR2 | +Inquiry |
RFL20689GF | Recombinant Full Length Gorilla Gorilla Gorilla Toll-Like Receptor 2(Tlr2) Protein, His-Tagged | +Inquiry |
TLR2-4731R | Recombinant Rhesus monkey TLR2 Protein, His-tagged | +Inquiry |
TLR2-744H | Recombinant Human TLR2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR2-001RCL | Recombinant Rat TLR2 cell lysate | +Inquiry |
TLR2-439HCL | Recombinant Human TLR2 cell lysate | +Inquiry |
TLR2-001MCL | Recombinant Mouse TLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR2 Products
Required fields are marked with *
My Review for All TLR2 Products
Required fields are marked with *
0
Inquiry Basket