Recombinant Full Length Borrelia Burgdorferi Ybbr-Like Domain-Containing Protein Bb_0009 (Bb_0009) Protein, His-Tagged
Cat.No. : | RFL22496BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi YbbR-like domain-containing protein BB_0009 (BB_0009) Protein (O51042) (1-334aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-334) |
Form : | Lyophilized powder |
AA Sequence : | MEIGKKIINIIKLLFDDWQNKAISILIAILMFVAFNFNKIESITTEKEFKIILNDQIALG KIPDFSKIKITIKVNKDDLKYLDLNKIILFIEASSIKIPGSYKLPIKIKNLNSIHIAEYK LSKTNVLLNLDNKVSKLVKIEPKFKLIEKDGKGEYFIAKYNILPENLLVYGPEQELKKIN TIQTNVKEFDTRTLFVSDYLEVVPPNPLVMFEKSHVVVNIYLNKKYSNTTIKSPNLIFNN LKNGLEIKDKEKIINSENKMFVKIKTRLSEKQIKAHINNQNISLAFDLADIKTPGIYNIA ANIILKENINETEIYDYEPKKIKLEIIESSEIKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BB_0009 |
Synonyms | BB_0009; YbbR-like domain-containing protein BB_0009 |
UniProt ID | O51042 |
◆ Native Proteins | ||
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAS2R42-1241HCL | Recombinant Human TAS2R42 293 Cell Lysate | +Inquiry |
SMARCE1-1667HCL | Recombinant Human SMARCE1 293 Cell Lysate | +Inquiry |
ANXA7-8826HCL | Recombinant Human ANXA7 293 Cell Lysate | +Inquiry |
KIAA0408-4976HCL | Recombinant Human KIAA0408 293 Cell Lysate | +Inquiry |
DLL1-001RCL | Recombinant Rat DLL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BB_0009 Products
Required fields are marked with *
My Review for All BB_0009 Products
Required fields are marked with *
0
Inquiry Basket