Recombinant Full Length Borrelia Burgdorferi Uncharacterized Protein Bb_0039 (Bb_0039) Protein, His-Tagged
Cat.No. : | RFL34366BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Uncharacterized protein BB_0039 (BB_0039) Protein (O51068) (1-500aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-500) |
Form : | Lyophilized powder |
AA Sequence : | MRKRSRKVKNDLVVLESKEKKVGMWGIFALILIVFGFIIAPLLPGIFDNAHSSGLKFGSY KGQPIYYKKDSKFAKYVNYYSNLYSRLQGNAKNINTDYNAWYLAFMKYVEDVAFLDLVKK YNFYISKEMLNKNLLKSPEYLDSSGNFSSKRYNKASDYQKVKIYDDMVENILFSNVKIFL NSNLIFPDSLFDMIKNMSTVERHISYLSLSYQDFSNKEVISYAEKNLNLFKRLSLASIRF KNMNDARTAHDKLLNKTPFEELAKLYSDDIANFKGVVSLDKYYFDLDLNVEKKEDLNSIF SLREGEFSKPIKIKNKNEYQIYKAFSNVHDFDKNSDRDISSVKNYIETYEPSVIEGYLEN KLSDFLGDVKFSSLSQVLEKYQLSLKEEIVNLSYNINVYPNTLKELVEFNNSKSFYDIIF GLKENSWSKPFVANKKVYLFFLNSVKKRSNQLKDEIKNEKILDNFNIANSGLITDFLLNK KDFVNNFNESFFALQNFSQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BB_0039 |
Synonyms | BB_0039; Uncharacterized protein BB_0039 |
UniProt ID | O51068 |
◆ Recombinant Proteins | ||
RFL17955RF | Recombinant Full Length Rat Nadph Oxidase 3(Nox3) Protein, His-Tagged | +Inquiry |
SAP015A-003-2700S | Recombinant Staphylococcus aureus (strain: CDC61, other: HA-MRSA) SAP015A_003 protein, His-tagged | +Inquiry |
LEAP2-1558H | Recombinant Human LEAP2 protein, His & GST-tagged | +Inquiry |
HBA2-3490HF | Recombinant Full Length Human HBA2 Protein, GST-tagged | +Inquiry |
DPF1-4620H | Recombinant Human DPF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
GFP-36B | Native Bovine GFP | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP8-7830HCL | Recombinant Human CASP8 293 Cell Lysate | +Inquiry |
UBOX5-548HCL | Recombinant Human UBOX5 293 Cell Lysate | +Inquiry |
BPIFB6-175HCL | Recombinant Human BPIFB6 cell lysate | +Inquiry |
MT1H-4100HCL | Recombinant Human MT1H 293 Cell Lysate | +Inquiry |
DHRS3-6937HCL | Recombinant Human DHRS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BB_0039 Products
Required fields are marked with *
My Review for All BB_0039 Products
Required fields are marked with *
0
Inquiry Basket