Recombinant Full Length Borrelia Burgdorferi Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL13007BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Prolipoprotein diacylglyceryl transferase(lgt) Protein (O51337) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MPNYINYPSWLHPEVIQGIPITWYSLSYILIILISYKFIWYQIQSDNVDIKKEDYEIFMF SLVLGAILGGRLASTLVYDKSGIYYSNPWLILLPFDQHWNFTGFRGMAIHGGFLGAIIAP LITINTNLKNTNVQKYFLKLTDYGSIAFSSGYILGRLANFANAELYGRVMKGGIIFPNAE PFDTNIPGVKEFASSVGLEISPHDLLINLPRIPSQLIEGFFEGPVTFLLLWFLFKKIKKY DGFIFGVYVMLYAFFRFFIEYLREPDKELGFIITYKPITSLSEFSFLNISMGQILSLTLM LSGLIWIIVTKKIADKKIKNNTNLAYKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; BB_0362; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | O51337 |
◆ Recombinant Proteins | ||
RPL39-3991R | Recombinant Rhesus monkey RPL39 Protein, His-tagged | +Inquiry |
NRG4-167 | Recombinant NRG4 Protein, GST-tagged | +Inquiry |
Cd14-1385M | Recombinant Mouse Cluster Of Differentiation 14, His-tagged | +Inquiry |
MICA-6630H | Recombinant Human MICA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
APOE-238HFL | Active Recombinant Full Length Human APOE Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-397H | Native Human High Density Lipoprotein, DiI labeled | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
LEL/LEA-070TB | Native Tomato Lycopersicon esculentum Lectin (LEL/LEA) | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
IPMK-866HCL | Recombinant Human IPMK cell lysate | +Inquiry |
LCOR-976HCL | Recombinant Human LCOR cell lysate | +Inquiry |
HMX2-5464HCL | Recombinant Human HMX2 293 Cell Lysate | +Inquiry |
SPEM1-1521HCL | Recombinant Human SPEM1 293 Cell Lysate | +Inquiry |
CCDC92-164HCL | Recombinant Human CCDC92 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket