Recombinant Full Length Bordetella Petrii Upf0761 Membrane Protein Bpet3042 (Bpet3042) Protein, His-Tagged
Cat.No. : | RFL126BF |
Product Overview : | Recombinant Full Length Bordetella petrii UPF0761 membrane protein Bpet3042 (Bpet3042) Protein (A9IT56) (1-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella petrii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-452) |
Form : | Lyophilized powder |
AA Sequence : | MSHSAGPGAAQPATAAAPRQRTPWITRVGRVFRFAAQRADEEKLLQVASSLTFTTVLGIV PMLAVVLSLFTAFPVFQDFRLALEDFLANSLMPPAVSDNIMDYLNQFAYQASRLTAIGGA FLVVTSLLLIMTIDKTFNDIWHVTRQRPLPQRALVYWAVVTLGPVVAGASLWATSFLARE SLGLVRDVPEIVSLAISFLPLILTGLGFAALFVVVPNRHVYWRDALVGGFGTAIVLELMK AAFAYYLTRFPTYTVIYGAFATLPIFLLWIYLSWLAVLFGATVAASAPLIRLGRWEINRS PGAPFIDALAVLRALHAAQGMRPAGRSASALAKRLHLHHDELNAVLEKLENLGLAARTAE QRWILACDPRSTTLEPVFDNFLLDRHQPRLRDDPQVVQAAAAVLGQDGGQAPTLEELAGL AHNTPVGLAAIVPLEAGKNSRRGPHAPGESSC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bpet3042 |
Synonyms | Bpet3042; UPF0761 membrane protein Bpet3042 |
UniProt ID | A9IT56 |
◆ Recombinant Proteins | ||
CALU-12H | Recombinant Active Human CALU Protein (20-315aa) | +Inquiry |
BSG-680R | Recombinant Rat BSG Protein, His (Fc)-Avi-tagged | +Inquiry |
ADCY5-6199C | Recombinant Chicken ADCY5 | +Inquiry |
SLC25A19-400H | Recombinant Human SLC25A19 Protein, His&GST-tagged | +Inquiry |
ATF4-1074HF | Recombinant Full Length Human ATF4 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
IgG-348G | Native Hamster Gamma Globulin Fraction | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM9B-592HCL | Recombinant Human FAM9B cell lysate | +Inquiry |
ARHGAP25-8741HCL | Recombinant Human ARHGAP25 293 Cell Lysate | +Inquiry |
DUSP3-001HCL | Recombinant Human DUSP3 cell lysate | +Inquiry |
CSNK1D-7242HCL | Recombinant Human CSNK1D 293 Cell Lysate | +Inquiry |
ARSA-3085MCL | Recombinant Mouse ARSA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bpet3042 Products
Required fields are marked with *
My Review for All Bpet3042 Products
Required fields are marked with *
0
Inquiry Basket