Recombinant Full Length Bombyx Mori Octopamine Receptor Protein, His-Tagged
Cat.No. : | RFL35431BF |
Product Overview : | Recombinant Full Length Bombyx mori Octopamine receptor Protein (Q17232) (1-479aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Silk moth |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-479) |
Form : | Lyophilized powder |
AA Sequence : | MGQAATHDANNYTSINYTEIYDVIEDEKDVCAVADEPNIPCSFGISLAVPEWEAICTAII LTMIIISTVVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQW VFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLFMIGIVWI LSLVISSPPLLGWNDWPEVFEPDTPCRLTSQPGFVIFSSSGSFYIPLVIMTVVYFEIYLA TKKRLRDRAKATKISTISSGRNKYETKESDPNDQDSVSSDANPNEHQGGTRLVAENEKKH RTRKLTPKKKPKRRYWSKDDKSHNKLIIPILSNENSVTDIGENLENRNTSSESNSKETHE DNMIEITEAAPVKIQKRPKQNQTNAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWL PFFVIYLVIPFCVSCCLSNKFINFITWLGYVNSALNPLIYTIFNMDFRRAFKKLLFIKC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bombyx mori Octopamine receptor |
Synonyms | Octopamine receptor |
UniProt ID | Q17232 |
◆ Recombinant Proteins | ||
PTK6B-4547Z | Recombinant Zebrafish PTK6B | +Inquiry |
S-062S | Recombinant SARS-CoV-2 Spike RBD (Y508H) Mutant Protein, His-tagged | +Inquiry |
Nop16-4459M | Recombinant Mouse Nop16 Protein, Myc/DDK-tagged | +Inquiry |
IRF3-2892H | Recombinant Human IRF3 Protein (Met1-Ser123), N-His tagged | +Inquiry |
CLTA-6787H | Recombinant Human Clathrin, Light Chain A, His-tagged | +Inquiry |
◆ Native Proteins | ||
CSH1-31024TH | Native Human CSH1 | +Inquiry |
Adv2-10 | Native Adenovirus Type 2 Hexon Antigen | +Inquiry |
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
b-Glucosidase-10S | Active Native Sweet Almonds b-Glucosidase | +Inquiry |
Tyrosinase-39 | Native Tyrosinase, Enzyme Activity | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM69-1528HCL | Recombinant Human TRIM69 cell lysate | +Inquiry |
SERINC1-1944HCL | Recombinant Human SERINC1 293 Cell Lysate | +Inquiry |
CA12-3067MCL | Recombinant Mouse CA12 cell lysate | +Inquiry |
FAM184A-6400HCL | Recombinant Human FAM184A 293 Cell Lysate | +Inquiry |
PLSCR2-3095HCL | Recombinant Human PLSCR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bombyx mori Octopamine receptor Products
Required fields are marked with *
My Review for All Bombyx mori Octopamine receptor Products
Required fields are marked with *
0
Inquiry Basket