Recombinant Full Length Blakeslea Trispora Bifunctional Lycopene Cyclase/Phytoene Synthase(Carra) Protein, His-Tagged
Cat.No. : | RFL11017BF |
Product Overview : | Recombinant Full Length Blakeslea trispora Bifunctional lycopene cyclase/phytoene synthase(carRA) Protein (Q67GH9) (1-608aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Blakeslea trispora (Choanephora trispora) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-608) |
Form : | Lyophilized powder |
AA Sequence : | MSILTYLEFHLYYTLPVLAALCWLLKPFHSQQDNLKYKFLMLMAASTASIWDNYIVYHRA WWYCPTCVVAVIGYVPLEEYMFFIIMTLMTVAFSNFVMRWHLHTFFIRPNTSWKQTLLVR LVPVSALLAITYHAWHLTLPNKPSFYGSCILWYACPVLAILWLGAGEYILRRPVAVLLSI VIPSVYLCWADIVAISAGTWHISLRTSTGKMVVPDLPVEECLFFTLINTVLVFATCAIDR AQAILHLYKSSVQNQNPKQAISLFQHVKELAWAFCLPDQMLNNELFDDLTISWDILRKAS KSFYTASAVFPSYVRQDLGVLYAFCRATDDLCDDESKSVQERRDQLDLTRQFVRDLFSQK TSAPIVIDWELYQNQLPASCISAFRAFTRLRHVLEVDPVEELLDGYKWDLERRPILDEQD LEAYSACVASSVGEMCTRVILAQDQKENDAWIIDRAREMGLVLQYVNIARDIVTDSETLG RCYLPQQWLRKEETEQIQQGNARSLGDQRLLGLSLKLVGKADAIMVRAKKGIDKLPANCQ GGVRAACQVYAAIGSVLKQQKTTYPTRAHLKGSERAKIALLSVYNLYQSEDKPVALRQAR KIKSFFVD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | carRA |
Synonyms | carRA; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | Q67GH9 |
◆ Recombinant Proteins | ||
CCL18-200H | Recombinant Human CCL18 protein | +Inquiry |
Srgap2-6125M | Recombinant Mouse Srgap2 Protein, Myc/DDK-tagged | +Inquiry |
SEPT3-4985R | Recombinant Rat SEPT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
B2M-314D | Recombinant Dog TRIM21 Protein, His/GST-tagged | +Inquiry |
ACER1-251M | Recombinant Mouse ACER1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CAPN1-65P | Active Native Porcine Porcine Calpain 1 | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
Protein C-89H | Native Human Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM176B-985HCL | Recombinant Human TMEM176B 293 Cell Lysate | +Inquiry |
Esophagus-740R | Rabbit Esophagus Lysate, Total Protein | +Inquiry |
ENPP3-001CCL | Recombinant Cynomolgus ENPP3 cell lysate | +Inquiry |
HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
TMPRSS15-2800HCL | Recombinant Human PRSS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All carRA Products
Required fields are marked with *
My Review for All carRA Products
Required fields are marked with *
0
Inquiry Basket