Recombinant Full Length Bat Coronavirus 512/2005 Membrane Protein(M) Protein, His-Tagged
Cat.No. : | RFL23889BF |
Product Overview : | Recombinant Full Length Bat coronavirus 512/2005 Membrane protein(M) Protein (Q0Q463) (1-227aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-227) |
Form : | Lyophilized powder |
AA Sequence : | MSSNQSVPVEEVIKHLRNWNFSWNIILTILLVVLQYGHYKYSRVLYGLKMAILWLLWPLV LALSIFDAWASFNVNWVFFAFSILMACVTAVLWIMYFVNSIRLWRRTHSWWSYNPETDSI LSVSVLGRHVCLPILGAPTGVTLTLLNGTLLVEGYQVATGVQVNNLPGYVTVAKASTTIV YQRVGRSMNANSSTGWAFFVKSKHGDYYAAANPTEVVTDSEKILHLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein |
UniProt ID | Q0Q463 |
◆ Native Proteins | ||
ORM1-27283TH | Native Human ORM1 | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
RV-11 | Native Rubella Virus Antigen | +Inquiry |
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Liver-148H | Human Fetal Liver Membrane Lysate | +Inquiry |
Brain-43R | Rabbit Brain Lysate | +Inquiry |
CHRM5-7518HCL | Recombinant Human CHRM5 293 Cell Lysate | +Inquiry |
RGL1-1497HCL | Recombinant Human RGL1 cell lysate | +Inquiry |
MRPL43-4165HCL | Recombinant Human MRPL43 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket