Recombinant Full Length Bartonella Quintana Type Iv Secretion System Protein Virb10(Virb10) Protein, His-Tagged
Cat.No. : | RFL31354BF |
Product Overview : | Recombinant Full Length Bartonella quintana Type IV secretion system protein virB10(virB10) Protein (Q6FYW1) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bartonella quintana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MKDEIDENNINDRSTIKDGQGKKLHSNTSKAVALLVLLGVCGYLAYSTLITNKKQPVELP KEAIIKQTERFRPAQPKPVLLEPTEKNNLLLPKVELPTPKRNQTNADDSLLEAAQRAPVL AYASPQKSQANAEKNNDTSPNQLERKPDETAQRFNHLLKPTNLEGIHASTLTNRNYIIAM GASIPCILETAISSDQQGFTSCIVSRDILSDNGRVVLLDKGTQIVGEYRSGLKKGQNRLF VLWNRAKTPSGVIITLASPATDALGRSGVDGDVDNHWFERIGSALLVSIVRDATNYARNR LPKDQDKNSSDTISSGPNIANIVVENYANIPPTLTKNQGEMVNVFVARDLDFSSVYKLKV IEDKKQIVNRSISRNFYKNSAVILK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB10 |
Synonyms | virB10; BQ10610; Type IV secretion system protein virB10 |
UniProt ID | Q6FYW1 |
◆ Recombinant Proteins | ||
ACTRT1-272C | Recombinant Cynomolgus ACTRT1 Protein, His-tagged | +Inquiry |
Camk4-754M | Recombinant Mouse Camk4 Protein, MYC/DDK-tagged | +Inquiry |
CDKL1-529H | Recombinant Human CDKL1 Protein, GST-His-tagged | +Inquiry |
COP20 | Recombinant human rhinovirus 3C Protease, GST-tagged | +Inquiry |
BRSK2-257H | Active Recombinant Human BRSK2, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TF-323H | Native Human Transferrin Fluorescein | +Inquiry |
Lectin-1796L | Active Native Lotus Tetragonolobus Lectin Protein, Agarose bound | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHISA4-1856HCL | Recombinant Human SHISA4 293 Cell Lysate | +Inquiry |
LOC441488-4682HCL | Recombinant Human LOC441488 293 Cell Lysate | +Inquiry |
ZNF71-2079HCL | Recombinant Human ZNF71 cell lysate | +Inquiry |
SGMS1-592HCL | Recombinant Human SGMS1 lysate | +Inquiry |
FAM129A-6431HCL | Recombinant Human FAM129A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virB10 Products
Required fields are marked with *
My Review for All virB10 Products
Required fields are marked with *
0
Inquiry Basket