Recombinant Full Length Bacteroides Thetaiotaomicron Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL7414BF |
Product Overview : | Recombinant Full Length Bacteroides thetaiotaomicron Undecaprenyl-diphosphatase(uppP) Protein (Q8A2U3) (1-264aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacteroides thetaiotaomicron |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-264) |
Form : | Lyophilized powder |
AA Sequence : | MSWLEAMILGLIQGLTEYLPVSSSGHLAIGSALFGIQGEENLAFTIVVHVATVCSTLVIL WKEIDWIFKGLFKFQMNDETRYVINIVISMIPIGIVGVFFKDYVEAIFGSGLMIVGCMLL LTAALLSFSYYYKPRQKDKISMKDAFIIGLAQACAVLPGLSRSGSTIATGLLLGDNKAKL AQFSFLMVIPPILGEALLDSVKMMKGEDVVGDIPALSLIVGFLAAFVAGCLACKWMINIV KKGKLIYFAIYCAIAGLAVIITQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; bacA; upk; BT_3212; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q8A2U3 |
◆ Recombinant Proteins | ||
GTF2B-3377HF | Recombinant Full Length Human GTF2B Protein, GST-tagged | +Inquiry |
TPBGL-2278H | Recombinant Human TPBGL Protein, MYC/DDK-tagged | +Inquiry |
RASSF4-3426H | Recombinant Human RASSF4 protein, His-tagged | +Inquiry |
DRP2-1619R | Recombinant Rat DRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL22574SF | Recombinant Full Length Biopolymer Transport Protein Exbb(Exbb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
Factor Xa-64H | Native Human Factor Xa | +Inquiry |
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCEA3-1748HCL | Recombinant Human TCEA3 cell lysate | +Inquiry |
MANF-2212HCL | Recombinant Human MANF cell lysate | +Inquiry |
Heart-490C | Chicken Heart Lysate, Total Protein | +Inquiry |
ADH5-30HCL | Recombinant Human ADH5 cell lysate | +Inquiry |
FCGR2-2959MCL | Recombinant Mouse FCGR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket