Recombinant Full Length Bacillus Subtilis Uncharacterized Serine Protease Yyxa(Yyxa) Protein, His-Tagged
Cat.No. : | RFL33518BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized serine protease yyxA(yyxA) Protein (P39668) (1-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-400) |
Form : | Lyophilized powder |
AA Sequence : | MVDYEREEEHTTPEQPKRSKKGYFLSSLIGVIVGAVLMAFIMPYLSNEGLDTGALDQQQN NNGRESIRTVNVSVNNAVTKIVSNMSPAVVGVVNIQKSDIWGESGEAGSGSGVIYKKNDH SAYVVTNHHVIEGASQIEISLKDGSRVSADLVGSDQLMDLAVLRVKSDKIKAVADFGNSD KVKSGEPVIAIGNPLGLEFAGSVTQGVISGTERAIPVDSNGDGQPDWNAEVLQTDAAINP GNSGGALLNMDGKVIGINSMKIAESAVEGIGLSIPSKLVIPVIEDLERYGKVKRPFLGIE MKSLSDIASYHWDETLKLPKNVTNGAVVMGVDAFSPAGKAGLKELDVITEFDGYKVNDIV DLRKRLYQKKVGDRVKVKFYRGGKEKSVDIKLSSADQLGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yyxA |
Synonyms | yyxA; yycK; BSU40360; Uncharacterized serine protease YyxA |
UniProt ID | P39668 |
◆ Native Proteins | ||
FSH-93P | Active Native Porcine FSH | +Inquiry |
Chitosan-003C | Native Crawfish Chitosan Water Soluble | +Inquiry |
Angiostatin K1-4-22H | Native Human Angiostatin K1-4 Protein | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC19-1970HCL | Recombinant Human ZDHHC19 cell lysate | +Inquiry |
GTF2H2-5697HCL | Recombinant Human GTF2H2 293 Cell Lysate | +Inquiry |
PROKR2-2834HCL | Recombinant Human PROKR2 293 Cell Lysate | +Inquiry |
ZNF471-2032HCL | Recombinant Human ZNF471 cell lysate | +Inquiry |
CACNB4-7902HCL | Recombinant Human CACNB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yyxA Products
Required fields are marked with *
My Review for All yyxA Products
Required fields are marked with *
0
Inquiry Basket