Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Yfhp(Yfhp) Protein, His-Tagged
Cat.No. : | RFL6732BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized protein yfhP(yfhP) Protein (O31583) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIR NHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAI RPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILVGYYLVRLIMQL RIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVP ETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGH DLTIRSSYTGWIFSEEKLQKKLKLGSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yfhP |
Synonyms | yfhP; BSU08620; Uncharacterized protein YfhP |
UniProt ID | O31583 |
◆ Recombinant Proteins | ||
SPSB1-2941H | Recombinant Human SPSB1, GST-tagged | +Inquiry |
KEAP1-550H | Recombinant Human KEAP1, Gly & Pro tagged | +Inquiry |
HSPA5-7040C | Recombinant Chicken HSPA5 | +Inquiry |
SPIB-8643M | Recombinant Mouse SPIB Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR2-2315HF | Recombinant Full Length Human CXCR2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IGHA1-18H | Native Human IgA1 | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
H1F0-01B | Native Bovine H1F0 Protein | +Inquiry |
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SART1-2059HCL | Recombinant Human SART1 293 Cell Lysate | +Inquiry |
C1orf51-8156HCL | Recombinant Human C1orf51 293 Cell Lysate | +Inquiry |
Spinal cord-460H | Human Spinal cord Lupus Lysate | +Inquiry |
ITGA1-5137HCL | Recombinant Human ITGA1 293 Cell Lysate | +Inquiry |
GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yfhP Products
Required fields are marked with *
My Review for All yfhP Products
Required fields are marked with *
0
Inquiry Basket