Recombinant Full Length Bacillus Subtilis Uncharacterized Membrane Protein Yfkq(Yfkq) Protein, His-Tagged
Cat.No. : | RFL13481BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized membrane protein yfkQ(yfkQ) Protein (O34486) (1-513aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-513) |
Form : | Lyophilized powder |
AA Sequence : | MNKRDKALQLIKELEDNQDRPISPNLKENLENLTLLTEGCSDIVFRQFDFGNGLCGFIVY IEGIVKSEHIQDHALRPFLMHLTDQIDEHEEALQNTLSISSVALETSMSKVAASIIEGNA VLFADGHSKGLILNIKGGQRRSIEEPITESTIRGSREGFTESLRVNTALVRFRVKTFQLK MISFKIGTKTKTDVVLAYIDGLADPKVIDKAKKRIKKIKIDAVLESGYIEEFIEDDTYSP FPQLQYTERPDTVAAQLLEGRFAIFTDNTPFVLTGPITFWQLMQASEDYYERYLMSNLIR WLRYMFLFVALYLPAIYVAVITYHQDLMPTNLMFSVASAREPIPFPAIIEALIMEISFEA LREAGVRLPKTIGQTVSILGALVIGTAAVEAGIVSAPMVIIVSLTGIASFTIPRFNLAIS IRMLRFPLMFLASIFGIFGIMLGTIILVLHLCKLQSFGIPYLSGISPFKRDEVKDIFVRA PWWTMTRRPGTYSRGNGQKGAKREDPKDEENNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yfkQ |
Synonyms | yfkQ; BSU07790; Uncharacterized membrane protein YfkQ |
UniProt ID | O34486 |
◆ Recombinant Proteins | ||
IGF2BP3-8068M | Recombinant Mouse IGF2BP3 Protein | +Inquiry |
GGT-0332B | Recombinant Bacillus subtilis GGT protein, His-tagged | +Inquiry |
MBL2-2330H | Recombinant Human MBL2 protein | +Inquiry |
RFL12312SF | Recombinant Full Length Saccharomyces Cerevisiae Cdp-Diacylglycerol--Serine O-Phosphatidyltransferase(Cho1) Protein, His-Tagged | +Inquiry |
TBPL2-12810Z | Recombinant Zebrafish TBPL2 | +Inquiry |
◆ Native Proteins | ||
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Parotid -156H | Human Fetal Parotid Lysate | +Inquiry |
CRYBB2-7261HCL | Recombinant Human CRYBB2 293 Cell Lysate | +Inquiry |
SORBS2-1570HCL | Recombinant Human SORBS2 293 Cell Lysate | +Inquiry |
PRR14-2815HCL | Recombinant Human PRR14 293 Cell Lysate | +Inquiry |
KAT2A-290HCL | Recombinant Human KAT2A HEK293T cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yfkQ Products
Required fields are marked with *
My Review for All yfkQ Products
Required fields are marked with *
0
Inquiry Basket