Recombinant Full Length Bacillus Subtilis Uncharacterized Glycosyltransferase Ykot(Ykot) Protein, His-Tagged
Cat.No. : | RFL12414BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Uncharacterized glycosyltransferase ykoT(ykoT) Protein (O34755) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MKQSQPVLTIVVPCFNEEEVFQETSHQLTEVVDDLIEEKLIAEDSKILFVDDGSKDRTWA LIAMESIRNKKVTGLKLACNVGHQKALLAGLHKAKNRSDCVISIDADLQDDISVIRDFML KYHEGCEIVYGVRRSRKTDTFFKRTTALGFYRLMNKLGIKLIYNHADFRLMNKRSLEELE RYPEANLFLRGIVPMIGFKSAEVLYDRKERFAGKTKYPLKKMLSFAFNGITSFSVAPIRF FTLLGFVLFFLSAVAGIGAFIQKLLGHTNAGWASLIISIWFLGGLQLMGIGIIGEYIGTI FSEVKRRPKYAIDIDLYNEQLSPLQRQEKERLEKKYS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ykoT |
Synonyms | ykoT; BSU13390; Uncharacterized glycosyltransferase YkoT |
UniProt ID | O34755 |
◆ Recombinant Proteins | ||
RFL5101PF | Recombinant Full Length Pseudomonas Stutzeri Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
KDM5BB-388Z | Recombinant Zebrafish KDM5BB | +Inquiry |
DRD5-1992H | Recombinant Human DRD5 Protein (Asn351-His477), His tagged | +Inquiry |
ATP1A1-301593H | Recombinant Human ATP1A1 protein, GST-tagged | +Inquiry |
BLAZ-2624S | Recombinant Staphylococcus aureus (strain: NE 3008) BLAZ protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GFP-36B | Native Bovine GFP | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS1-1499HCL | Recombinant Human RGS1 cell lysate | +Inquiry |
Pancreas-436S | Sheep Pancreas Lysate, Total Protein | +Inquiry |
THAP2-1106HCL | Recombinant Human THAP2 293 Cell Lysate | +Inquiry |
SFTPB-1897HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
GDPD2-5963HCL | Recombinant Human GDPD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ykoT Products
Required fields are marked with *
My Review for All ykoT Products
Required fields are marked with *
0
Inquiry Basket