Recombinant Full Length Bacillus Subtilis Stage Iii Sporulation Protein Ae(Spoiiiae) Protein, His-Tagged
Cat.No. : | RFL3555BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Stage III sporulation protein AE(spoIIIAE) Protein (P49782) (25-399aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-399) |
Form : | Lyophilized powder |
AA Sequence : | AGNAEQTEDHAETAEQLAERTAASLETDKIGEFWNDIMTEYGGLLPESQKGSLMEFINGD KSFSPQEWLKALFSYLFHEVLANGKLLGTLILLTIFCVILQLLQNAFQQSTVSKVAYSIV YMVLIILALNSFHVAINYATEAIQTMTSFILALIPLLLALLASSGGAVSAAFFHPVILFL MNTSGLLIQNIVMPLIFLSAILSIVSTMTEQYKVTQLANLLRNIAIGALAVFLTIFLGVI SVQGASAAVTDGITLRTAKFITGNFIPVLGRMFTDATDTVISASLLLKNTVGILGVAILI CIAAFPAIKVLSLAFIYKLAAAILQPLGGGPVITCLDVISKSVIYIFAALAIVSLMFFLS LTVIITAGNLTMMMK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | spoIIIAE |
Synonyms | spoIIIAE; BSU24390; Stage III sporulation protein AE |
UniProt ID | P49782 |
◆ Recombinant Proteins | ||
RFL34817MF | Recombinant Full Length Mouse Gap Junction Delta-2 Protein(Gjd2) Protein, His-Tagged | +Inquiry |
CLYBL-1756H | Recombinant Human CLYBL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EHHADH-11800Z | Recombinant Zebrafish EHHADH | +Inquiry |
IMPG1-2140H | Recombinant Human IMPG1 Protein, MYC/DDK-tagged | +Inquiry |
FCHO2-2918Z | Recombinant Zebrafish FCHO2 | +Inquiry |
◆ Native Proteins | ||
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
ADVag-281V | Active Native ADV Protein | +Inquiry |
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
Fxa-66R | Native Rat Factor Ixa | +Inquiry |
HP-200H | Native Human Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf123-8184HCL | Recombinant Human C1orf123 293 Cell Lysate | +Inquiry |
Ovary-647B | Bovine Ovary Lysate, Total Protein | +Inquiry |
GRP-5730HCL | Recombinant Human GRP 293 Cell Lysate | +Inquiry |
POLI-3046HCL | Recombinant Human POLI 293 Cell Lysate | +Inquiry |
MARK3-582HCL | Recombinant Human MARK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All spoIIIAE Products
Required fields are marked with *
My Review for All spoIIIAE Products
Required fields are marked with *
0
Inquiry Basket