Recombinant Full Length Bacillus Subtilis Putative Sigma L-Dependent Transcriptional Regulator Yqir(Yqir) Protein, His-Tagged
Cat.No. : | RFL25159BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Putative sigma L-dependent transcriptional regulator yqiR(yqiR) Protein (P54529) (1-692aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-692) |
Form : | Lyophilized powder |
AA Sequence : | MQKVLIVGAGKRGTALLHILIKTAIIDIIAVVDKDPEAPGLKEAEQYGIAVSSDWKPYIQ QKPDIVIHTTGDQAVFDELLQRKHEDTIVMPGKMAYIVFQLMEEKQHLIQMLKEQTYKYD RIFNSTHDGMIFIDINEEIILFNHMAEKMVGKKREEVIGRPIKEVIPSTKMPRILKTRVP EYNQKQLLGDHLQIVTTRLPIIDEGGRLLGALCVFKDITDAVELAEEVTNLKQVRTMLEA IIQSSDEAISVVDENGIGLLINKAYTKMTGLSEKEVIGKPANTDISEGESMHLKVLETRR PVRGVRMKVGPNEKEVIVNVAPVIVDGILKGSVGVIHDVSEIKMLTAELNRARQIIRTLE AKYTFDDIIGKSEQMLVALEQAKLGAKTPATILLRGESGTGKELFAHAIHNESDRKYNKF IRVNCAALSENLLESELFGYEDGAFSGAKRGGKKGLFEEANNGSIFLDEIGELTQNMQAK LLRVLQEKEIVRVGGTKAIPVNVRVIAATNVNIEKAMADGTFREDLYYRINRYPISIPPL RQRLEDIEALSVRLIQKINRDYGRNVKGLSQQALRALSAYHWPGNVRELENVLGRAMIFL NPHMEWIEKDHLPVFELEQKENDTDQGTGFDFPDIEGEKLSVAVEKFEAHLIQQTLEKHH FNRTKTAKALGVSIRNLYYKMDKYGLANEGMQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yqiR |
Synonyms | yqiR; BSU24100; Putative sigma L-dependent transcriptional regulator YqiR |
UniProt ID | P54529 |
◆ Recombinant Proteins | ||
ANKMY2-327R | Recombinant Rhesus monkey ANKMY2 Protein, His-tagged | +Inquiry |
Inip-3540M | Recombinant Mouse Inip Protein, Myc/DDK-tagged | +Inquiry |
THRSP-3223H | Recombinant Human THRSP, GST-tagged | +Inquiry |
TNFRSF10B-310H | Recombinant Human TNFRSF10B Protein, Fc/His-tagged | +Inquiry |
ISPG-2681B | Recombinant Bacillus subtilis ISPG protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN7-863HCL | Recombinant Human TSPAN7 cell lysate | +Inquiry |
SRP19-1478HCL | Recombinant Human SRP19 293 Cell Lysate | +Inquiry |
RSL24D1-2132HCL | Recombinant Human RSL24D1 293 Cell Lysate | +Inquiry |
CSH2-7246HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
C1QTNF6-8135HCL | Recombinant Human C1QTNF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yqiR Products
Required fields are marked with *
My Review for All yqiR Products
Required fields are marked with *
0
Inquiry Basket