Recombinant Full Length Bacillus Subtilis Lipoteichoic Acid Synthase 2(Ltas2) Protein, His-Tagged
Cat.No. : | RFL23613BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Lipoteichoic acid synthase 2(ltaS2) Protein (O34952) (216-649aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (216-649) |
Form : | Lyophilized powder |
AA Sequence : | DSSDVTEVENYMKANYDVPNNVYFGKAEGKNVIYVSLESLQSFIIDYKIDGKEVTPFLNK LAHDNETFYFDNFFHQTGQGKTSDAEFMMENSLYPLAQGSVFVNKAQNTLQSVPAILKSK NYTSATFHGNTQTFWNRNEMYKAEGIDKFFDSAYYDMNEENTKNYGMKDKPFFKESMPLL ESLPQPFYTKFITLSNHFPFGMDEGDTDFPAGDFGDSVVDNYFQSAHYLDQSIEQFFNDL KKDGLYDKSIIVMYGDHYGISENHNKAMAKVLGKDEITDYDNAQLQRVPLFIHAAGVKGE KVHKYAGDVDVAPTILHLLGVDTKDYLMSGSDILSKEHREVIPFRNGDFISPKYTKISGK YYDTKTGKELDESEVDKSEDSLVKKELEMSDKIINGDLLRFYEPKGFKKVNPSDYDYTKH DEDSSETSKDNEDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ltaS2 |
Synonyms | ltaS2; yflE; BSU07710; Lipoteichoic acid synthase 2 |
UniProt ID | O34952 |
◆ Recombinant Proteins | ||
SAP079A-050-4207S | Recombinant Staphylococcus aureus (strain: CDCGA672) SAP079A_050 protein, His-tagged | +Inquiry |
S100A4-162H | Recombinant Human S100A4 | +Inquiry |
PRDX4-1759H | Recombinant Human PRDX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMA2-3868C | Recombinant Chicken BMA2 | +Inquiry |
VOM1R98-6538R | Recombinant Rat VOM1R98 Protein | +Inquiry |
◆ Native Proteins | ||
AGP-001B | Native Bovine AGP Protein | +Inquiry |
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
AMY2-5364P | Native Pig Amylase, Alpha 2B (pancreatic) | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CT45A2-7220HCL | Recombinant Human CT45A2 293 Cell Lysate | +Inquiry |
OSGEPL1-1261HCL | Recombinant Human OSGEPL1 cell lysate | +Inquiry |
RHEBL1-2357HCL | Recombinant Human RHEBL1 293 Cell Lysate | +Inquiry |
WDR77-333HCL | Recombinant Human WDR77 293 Cell Lysate | +Inquiry |
PAM16-1071HCL | Recombinant Human TIMM16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ltaS2 Products
Required fields are marked with *
My Review for All ltaS2 Products
Required fields are marked with *
0
Inquiry Basket