Recombinant Full Length Bacillus Megaterium Putative Stage Iv Sporulation Protein(Spoiv) Protein, His-Tagged
Cat.No. : | RFL32320BF |
Product Overview : | Recombinant Full Length Bacillus megaterium Putative stage IV sporulation protein(spoIV) Protein (P41028) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus megaterium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MKNGWTNFVIGTVRIRIVGKGIERFLNNCVRQQIMISNVHKVDGQLATATILLKDVKKIR ILIRNADCKIYFIRGRGFPFLTKRVIKNSGFALGFLSFFIILGLLSNMVWKVEISGAEPQ TEHQMTKQLAKIGVKRGEFQFLLESPEKIQRYLTDNMNNITWVGVEVRGTSYHFQVVEKN EPKPQQKTPYQHLIAKKKAIITNLFVEKGQPLVKVNDFVNEGEVLVSGIIGNEKNKKVVA AKGKVYGETWYKSEVEVPLKTDFQVLTGNGYTKHYLDFQAFKMPLWAFNKEKYTSKVTEK VEHPLYFFKWKLPLSYEKVAVREEQNSQRVYSKQEAVEKALEIGRKKLLSTLGEDAKIKG EKVLHQEQDNGKVRLSIHYQVIENIANTQPIIQGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | spoIV |
Synonyms | spoIV; BMD_4540; Putative stage IV sporulation protein |
UniProt ID | P41028 |
◆ Recombinant Proteins | ||
HCFC1R1-2803R | Recombinant Rat HCFC1R1 Protein | +Inquiry |
NFE2-2830R | Recombinant Rhesus Macaque NFE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNJ3-6955C | Recombinant Chicken KCNJ3 | +Inquiry |
LRRN3-3487R | Recombinant Rat LRRN3 Protein | +Inquiry |
Hsf4-5664R | Recombinant Rat Hsf4 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX16-3290HCL | Recombinant Human PEX16 293 Cell Lysate | +Inquiry |
CD5L-2302HCL | Recombinant Human CD5L cell lysate | +Inquiry |
ZFYVE21-174HCL | Recombinant Human ZFYVE21 293 Cell Lysate | +Inquiry |
DLC1-6913HCL | Recombinant Human DLC1 293 Cell Lysate | +Inquiry |
Pituitary-542E | Equine Pituitary Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All spoIV Products
Required fields are marked with *
My Review for All spoIV Products
Required fields are marked with *
0
Inquiry Basket