Recombinant Full Length Bacillus Halodurans Upf0365 Protein Bh1357(Bh1357) Protein, His-Tagged
Cat.No. : | RFL16447BF |
Product Overview : | Recombinant Full Length Bacillus halodurans UPF0365 protein BH1357(BH1357) Protein (Q9KD62) (1-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Halodurans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-331) |
Form : | Lyophilized powder |
AA Sequence : | MPVDLGLIILLGVIFIALAVLFTFVPVGLWISALAAGVKIGIFELVGMRLRRVIPRRVVE PLIKAVKAGLDLSTSKLEGHYLAGGNVDRVVNALIAAQRANIDLSFERCAAIDLAGRDVL QAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIDRLVGGAGEETVIARVGEGIV STIGSSDDHKKVLENPDTISQTVLKKGLDAGTAFEILSIDIADIDIGKNIGAGLQTDQAE ADKKIAQAKAEERRAMAVAKEQEMRAKVEEMRAKVVEAEAEVPMALSDALRKGNMGVMDY LNYQNVMADTDMRDSISKATGDQEADEKNDR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BH1357 |
Synonyms | floA; BH1357; Flotillin-like protein FloA |
UniProt ID | Q9KD62 |
◆ Recombinant Proteins | ||
TUBG1-11150Z | Recombinant Zebrafish TUBG1 | +Inquiry |
LRRC43-1699H | Recombinant Human LRRC43 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD3D & CD3E-1325M | Recombinant Mouse CD3D & CD3E protein(Met1-Ala105 & Met1-Asp108), His-Fc&Flag-Fc-tagged | +Inquiry |
RAP1AB-12579Z | Recombinant Zebrafish RAP1AB | +Inquiry |
USP46-456H | Recombinant Human ubiquitin specific peptidase 46, His-tagged | +Inquiry |
◆ Native Proteins | ||
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
Protein A-01S | Active Native Staphylococcus aureus Protein A | +Inquiry |
ECV-309S | Native Snake ECV- PROTHROMBIN ACTIVATOR | +Inquiry |
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM143-1000HCL | Recombinant Human TMEM143 293 Cell Lysate | +Inquiry |
CDADC1-7672HCL | Recombinant Human CDADC1 293 Cell Lysate | +Inquiry |
PAIP2-3458HCL | Recombinant Human PAIP2 293 Cell Lysate | +Inquiry |
FGFR4-1516RCL | Recombinant Rat FGFR4 cell lysate | +Inquiry |
DHRS13-6938HCL | Recombinant Human DHRS13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BH1357 Products
Required fields are marked with *
My Review for All BH1357 Products
Required fields are marked with *
0
Inquiry Basket