Recombinant Full Length Bacillus Cereus Upf0754 Membrane Protein Bcq_0944 (Bcq_0944) Protein, His-Tagged
Cat.No. : | RFL8081BF |
Product Overview : | Recombinant Full Length Bacillus cereus UPF0754 membrane protein BCQ_0944 (BCQ_0944) Protein (B9IR99) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MNIWLSMLTTTGLGAIIGGFTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVITNEQSLRHMLEKWDVAHVEK EATEKIEQVITEKIQSFLEEYYTYTWEQALPHSVHEKIENAIPNVSAFILKRAIHFFESE EGKSRLSKMIDDFFASRGTLLNLVGMFLGNVSVVDRVQPEVIKFLGQDGTKQLLTEVLQK EWEKLKGRDVKEVETFVEKEMIVSSILSAVKVEETVSKFLNQSVQQVCEPVRETIMEKVV PSAVTKGLKWGAENVASILNNLHLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGA LLGGMIGIVQGLLLLFLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BCQ_0944 |
Synonyms | BCQ_0944; UPF0754 membrane protein BCQ_0944 |
UniProt ID | B9IR99 |
◆ Recombinant Proteins | ||
Tnnt1-7948M | Recombinant Mouse Tnnt1 protein, His-tagged | +Inquiry |
ATP5G3-323C | Recombinant Cynomolgus ATP5G3 Protein, His-tagged | +Inquiry |
ROR2-3611C | Recombinant Chicken ROR2 | +Inquiry |
DHRS1-1254R | Recombinant Rhesus monkey DHRS1 Protein, His-tagged | +Inquiry |
TTC14-1690C | Recombinant Chicken TTC14 | +Inquiry |
◆ Native Proteins | ||
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
PSA-01H | Native Human PSA-ACT Complex Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COG3-379HCL | Recombinant Human COG3 cell lysate | +Inquiry |
LRR1-1398HCL | Recombinant Human LRR1 cell lysate | +Inquiry |
DDX50-7003HCL | Recombinant Human DDX50 293 Cell Lysate | +Inquiry |
POLR3F-3024HCL | Recombinant Human POLR3F 293 Cell Lysate | +Inquiry |
GPX8-5761HCL | Recombinant Human GPX8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCQ_0944 Products
Required fields are marked with *
My Review for All BCQ_0944 Products
Required fields are marked with *
0
Inquiry Basket