Recombinant Full Length Bacillus Cereus Upf0754 Membrane Protein Bcah820_0954 (Bcah820_0954) Protein, His-Tagged
Cat.No. : | RFL16925BF |
Product Overview : | Recombinant Full Length Bacillus cereus UPF0754 membrane protein BCAH820_0954 (BCAH820_0954) Protein (B7JSD7) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MNIWLSMLTTTGLGAIIGGFTNHLAIKMLFRPHRPMYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVITNEQSLRHMLGKWDVAHVEK EATEKIEQVITEKIQAFLEEYYTYTWEQALPHSVHEKIENAIPNVSAFILKRAIHFFESE EGKSRLSRMIDDFFASRGALLNLVGMFLGNVSVVDRVQPEVIKFLGQDGTKQLLTDVLQK EWEKLKGRDVKELETFVEKEMIVSSILSAVKVEETVSKFLNQSVQQVCEPVRETIIEKVV PNAVTKGLKWGGENVESILNNLHLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGA LLGGMIGIVQGLLLLFLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BCAH820_0954 |
Synonyms | BCAH820_0954; UPF0754 membrane protein BCAH820_0954 |
UniProt ID | B7JSD7 |
◆ Recombinant Proteins | ||
CREBBP-28400TH | Recombinant Human CREBBP | +Inquiry |
KLHL30-4862M | Recombinant Mouse KLHL30 Protein, His (Fc)-Avi-tagged | +Inquiry |
G-4267R | Recombinant Rabies virus G protein, His-SUMO-tagged | +Inquiry |
HYOU1-1725C | Recombinant Chicken HYOU1 | +Inquiry |
TPGS2-6238R | Recombinant Rat TPGS2 Protein | +Inquiry |
◆ Native Proteins | ||
Ribulose-122S | Native Ribulose-1 | +Inquiry |
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT34-4870HCL | Recombinant Human KRT34 293 Cell Lysate | +Inquiry |
Liver-279H | Human Liver (LT Lobe) Membrane Lysate | +Inquiry |
SLAMF1-2760HCL | Recombinant Human SLAMF1 cell lysate | +Inquiry |
FKBP1B-6209HCL | Recombinant Human FKBP1B 293 Cell Lysate | +Inquiry |
RNF125-545HCL | Recombinant Human RNF125 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BCAH820_0954 Products
Required fields are marked with *
My Review for All BCAH820_0954 Products
Required fields are marked with *
0
Inquiry Basket