Recombinant Full Length Bacillus Cereus Upf0754 Membrane Protein Bcah187_A1042 (Bcah187_A1042) Protein, His-Tagged
Cat.No. : | RFL12926BF |
Product Overview : | Recombinant Full Length Bacillus cereus UPF0754 membrane protein BCAH187_A1042 (BCAH187_A1042) Protein (B7HXM3) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MNIWLSMLTTTGLGAIIGGFTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVITNEQSLRHMLEKWDVAHVEK EATEKIEQVITEKIQAFLEEYYTYTWEQALPHSVHEKIENAIPNVSAFILGRATQFFESE EGKARLSKMIDDFFASRGTLLNLVGMFLGNVSVVDRVQPEVIKFLGQDGTKQLLTEVLQK ELEKLKGRDVKEVETFVEKEMIVSSILSAVKVEETVSKFLNQSVQQVCEPVRETIMEKVV PGVVTKGLKWGAENVASILNNLHLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGA LLGGMIGIVQGLLLLFLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BCAH187_A1042 |
Synonyms | BCAH187_A1042; UPF0754 membrane protein BCAH187_A1042 |
UniProt ID | B7HXM3 |
◆ Native Proteins | ||
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRSS22-509HCL | Recombinant Human PRSS22 lysate | +Inquiry |
CSNK1A1L-7243HCL | Recombinant Human CSNK1A1L 293 Cell Lysate | +Inquiry |
MRPS36-4134HCL | Recombinant Human MRPS36 293 Cell Lysate | +Inquiry |
RNASE7-2317HCL | Recombinant Human RNASE7 293 Cell Lysate | +Inquiry |
ST3GAL1-1442HCL | Recombinant Human ST3GAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCAH187_A1042 Products
Required fields are marked with *
My Review for All BCAH187_A1042 Products
Required fields are marked with *
0
Inquiry Basket