Recombinant Full Length Bacillus Cereus Upf0421 Protein Bc_2748(Bc_2748) Protein, His-Tagged
Cat.No. : | RFL14804BF |
Product Overview : | Recombinant Full Length Bacillus cereus UPF0421 protein BC_2748(BC_2748) Protein (Q81CK9) (1-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-351) |
Form : | Lyophilized powder |
AA Sequence : | MNQDRKWNIVGGRVIKTGIAVFLTVLVCDFFNIPTIFAVITAIVTIEPTATDSIKKGLIR FPASTIGSAYAMTFTFFLGHQAISYALAAMFTIVACQKLRLHAGTLVATLTAVAMIPITA NHYFTAFLIRLATTSTGIIVSTLVNFFIFPPHYTKMIFGCTEDLFAKTANIMEEWITALV AGKGVKKETAQDLSKLTLLLHKAIQFVQYEQKDWKYHQHTKKEMRSFLTMQKQLHILQQI IYHIDNLARVSIETCDWSQSEREILQRTIHSIIAILRNRCNEIDEEHFKLIAELDKQFWS YKNDLKDYKPNHYHHHFSSESIILFEVLSIHDMLEELKQISEKYEWENRFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BC_2748 |
Synonyms | BC_2748; UPF0421 protein BC_2748 |
UniProt ID | Q81CK9 |
◆ Recombinant Proteins | ||
KPNA7-4900M | Recombinant Mouse KPNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il27ra-5790R | Recombinant Rat Il27ra protein, His & T7-tagged | +Inquiry |
C1QL3-52H | Active Recombinant Human C1QL3 protein, Met/His-tagged | +Inquiry |
AP3S1-364H | Recombinant Human adaptor-related protein complex 3, sigma 1 subunit, His-tagged | +Inquiry |
RFL15918VF | Recombinant Full Length Vaccinia Virus Protein I2 (Vacwr071) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
HDLBP-86H | Native Human Lipoproteins | +Inquiry |
ALB-54C | Native Cyno monkey Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-876HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
CARTPT-911HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
IGHMBP2-5260HCL | Recombinant Human IGHMBP2 293 Cell Lysate | +Inquiry |
PRKCA-499HCL | Recombinant Human PRKCA lysate | +Inquiry |
ULK3-1883HCL | Recombinant Human ULK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BC_2748 Products
Required fields are marked with *
My Review for All BC_2748 Products
Required fields are marked with *
0
Inquiry Basket