Recombinant Full Length Bacillus Cereus Upf0397 Protein Bce_2667(Bce_2667) Protein, His-Tagged
Cat.No. : | RFL25160BF |
Product Overview : | Recombinant Full Length Bacillus cereus UPF0397 protein BCE_2667(BCE_2667) Protein (Q737I1) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MNKLSTKLVVAIGIGAALYGILGLWGFSIAPNTFIKPALAILTIFGALFGPVAGLLIGLI GHTVTDTIAGWGIWWGWVFSSGIIGFAMGLIQKRVGFSVKNGTYNKGDISYLAITGLIGI VIAIIFAGAFDIIVMGEPFDKIVIQVLGATIADVIVFLVLGLPITIGLAKSNKKHTHLKI EK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BCE_2667 |
Synonyms | BCE_2667; UPF0397 protein BCE_2667 |
UniProt ID | Q737I1 |
◆ Recombinant Proteins | ||
CDK5-0986H | Recombinant Human CDK5 Protein (Asp92-Gln273), N-His tagged | +Inquiry |
ACN9-452R | Recombinant Rat ACN9 Protein | +Inquiry |
RFL686OF | Recombinant Full Length Rabbit Cyclic Nucleotide-Gated Olfactory Channel(Cnga2) Protein, His-Tagged | +Inquiry |
S100A7A-5852H | Recombinant Human S100A7A Protein (Ser2-Gln101), N-GST tagged | +Inquiry |
PSME3IP1-540HFL | Active Recombinant Full Length Human PSME3IP1 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
Adv2-10 | Native Adenovirus Type 2 Hexon Antigen | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR3H-3022HCL | Recombinant Human POLR3H 293 Cell Lysate | +Inquiry |
CSRP1-7233HCL | Recombinant Human CSRP1 293 Cell Lysate | +Inquiry |
COCH-2373HCL | Recombinant Human COCH cell lysate | +Inquiry |
RAC3-2566HCL | Recombinant Human RAC3 293 Cell Lysate | +Inquiry |
NAMPT-491HCL | Recombinant Human NAMPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCE_2667 Products
Required fields are marked with *
My Review for All BCE_2667 Products
Required fields are marked with *
0
Inquiry Basket