Recombinant Full Length Bacillus Anthracis Upf0754 Membrane Protein Bameg_3697 (Bameg_3697) Protein, His-Tagged
Cat.No. : | RFL32776BF |
Product Overview : | Recombinant Full Length Bacillus anthracis UPF0754 membrane protein BAMEG_3697 (BAMEG_3697) Protein (C3LE57) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus anthracis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MNIWLSMLTTTGLGAIIGGFTNHLAIKMLFRPHRPMYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVITNEQSLRHMLGKWDVAHVEK EATEKIEQVITEKIQAFLEEYYTYTWEQALPHSVHEKIENAIPNVSAFILKRAIHFFESE EGKSRLSRMIDDFFASRGALLNLVGMFLGNVSVVDRVQPEVIKFLGQDGTKQLLTDVLQK EWEKLKGRDVKELETFVEKEMIVSSILSAVKVEETVSKFLNQSVQQVCEPVRETIIEKVV PNAVTKGLKWGGENVESILNNLHLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGA LLGGMIGIVQGLLLLFLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BAMEG_3697 |
Synonyms | BAMEG_3697; UPF0754 membrane protein BAMEG_3697 |
UniProt ID | C3LE57 |
◆ Native Proteins | ||
F9-26523H | Active Native Human F9 Protein | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RANGAP1-2532HCL | Recombinant Human RANGAP1 293 Cell Lysate | +Inquiry |
ARPP21-8680HCL | Recombinant Human ARPP21 293 Cell Lysate | +Inquiry |
VHL-410HCL | Recombinant Human VHL 293 Cell Lysate | +Inquiry |
PRSS30P-1106HCL | Recombinant Human PRSS30P cell lysate | +Inquiry |
OXGR1-3506HCL | Recombinant Human OXGR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAMEG_3697 Products
Required fields are marked with *
My Review for All BAMEG_3697 Products
Required fields are marked with *
0
Inquiry Basket