Recombinant Full Length Bacillus Amyloliquefaciens Upf0754 Membrane Protein Rbam_010020 (Rbam_010020) Protein, His-Tagged
Cat.No. : | RFL15731BF |
Product Overview : | Recombinant Full Length Bacillus amyloliquefaciens UPF0754 membrane protein RBAM_010020 (RBAM_010020) Protein (A7Z2Z0) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus velezensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MGIAGTFLFMIVIGAAIGAVTNHLAIQMLFRPYRPYYLFGKRVPFTPGLIPKRRDELAKQ MGLMVTNHLLTPEGIKKRLLSDTVKNQALLFAEQFTQKMAASEMTVHEALAAAGILNPQE KTDAWIDRFTDEKLSELYRKYEHRAIKDWLPDELQEKLDEKVPLAADYILKRSTDYFESE EGKDRLGNMIDDFLNSRGMLGSMVQMFLGNSSLADRVLPELLKFLRNEETKKLLADLLSQ EWGKLKSYTLYEADEKWNAKDLLFSMKKRALAALQTAPFFECRLGDIISRYEGEITGTYA PKLLDAALGSIAAHLEDVLKRLRLEEVVKEQVDQFPVERLEEMVLSISKREFKMITYLGG LLGGIIGAIQALFVILF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RBAM_010020 |
Synonyms | RBAM_010020; UPF0754 membrane protein RBAM_010020 |
UniProt ID | A7Z2Z0 |
◆ Native Proteins | ||
ALPI-8348B | Native Bovine ALPI | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
IP6K3-5185HCL | Recombinant Human IP6K3 293 Cell Lysate | +Inquiry |
ZNF606-38HCL | Recombinant Human ZNF606 293 Cell Lysate | +Inquiry |
PPM1N-652HCL | Recombinant Human PPM1N cell lysate | +Inquiry |
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
TMEM98-922HCL | Recombinant Human TMEM98 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBAM_010020 Products
Required fields are marked with *
My Review for All RBAM_010020 Products
Required fields are marked with *
0
Inquiry Basket