Recombinant Full Length Bacillus Amyloliquefaciens Protein Psie Homolog(Psie) Protein, His-Tagged
Cat.No. : | RFL24664BF |
Product Overview : | Recombinant Full Length Bacillus amyloliquefaciens Protein psiE homolog(psiE) Protein (A7Z6Z1) (1-138aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus velezensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-138) |
Form : | Lyophilized powder |
AA Sequence : | MRFSNNFKKAPYLLQALLNVCLFFLAIALSGLLISETWYIVQFVYKSLFNKVDSYYEMLG ELLIFFMYFEFIALIIKYFKSDFHFPLRYFIYIGITAVIRLIIIDHDQAISTFWWAMAIL AMICAFFIVNRRNSVVEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psiE |
Synonyms | psiE; RBAM_024070; Protein PsiE homolog |
UniProt ID | A7Z6Z1 |
◆ Native Proteins | ||
Apotransferrin-36M | Native Mouse Apotransferrin | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRPPRC-4652HCL | Recombinant Human LRPPRC 293 Cell Lysate | +Inquiry |
LMBRD1-4716HCL | Recombinant Human LMBRD1 293 Cell Lysate | +Inquiry |
DPT-6823HCL | Recombinant Human DPT 293 Cell Lysate | +Inquiry |
NRL-3693HCL | Recombinant Human NRL 293 Cell Lysate | +Inquiry |
Amygdala-1H | Human Amygdala(Alzheimer's Disease) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psiE Products
Required fields are marked with *
My Review for All psiE Products
Required fields are marked with *
0
Inquiry Basket