Recombinant Full Length Azorhizobium Caulinodans Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged
Cat.No. : | RFL20009AF |
Product Overview : | Recombinant Full Length Azorhizobium caulinodans NADH-quinone oxidoreductase subunit K(nuoK) Protein (A8I413) (1-102aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Azorhizobium caulinodans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-102) |
Form : | Lyophilized powder |
AA Sequence : | MEIGLSHYLTVAAILFTMGTLGIFLNRKNVIVILMSVELILLAVNINLVAFSAFQGNLVG QVFALLVLTVAAAEAAIGLAILVVFFRNRGSIAVEDINAMKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nuoK |
Synonyms | nuoK; AZC_1678; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K |
UniProt ID | A8I413 |
◆ Native Proteins | ||
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
GG-182B | Native Bovine Gamma Globulin | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERH-6555HCL | Recombinant Human ERH 293 Cell Lysate | +Inquiry |
MAGT1-4532HCL | Recombinant Human MAGT1 293 Cell Lysate | +Inquiry |
TBC1D3-1742HCL | Recombinant Human TBC1D3 cell lysate | +Inquiry |
DENND3-6976HCL | Recombinant Human DENND3 293 Cell Lysate | +Inquiry |
RIOK2-2335HCL | Recombinant Human RIOK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nuoK Products
Required fields are marked with *
My Review for All nuoK Products
Required fields are marked with *
0
Inquiry Basket