Recombinant Full Length Aura Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL6702AF |
Product Overview : | Recombinant Full Length Aura virus Structural polyprotein Protein (Q86925) (807-1244aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | AURAV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (807-1244) |
Form : | Lyophilized powder |
AA Sequence : | YEHTITVPNAPLNSYKALVERPGYAPLNLEVMVMNTQIIPSVKREYITCRYHTVVPSPQI KCCGTVECPKGEKADYTCKVFTGVYPFLWGGAQCFCDSENSQLSDKYVELSTDCATDHAE AVRVHTASVKSQLRITYGNSTAQVDVFVNGVTPARSKDMKLIAGPLSTTFSPFDNKVIIY HGKVYNYDFPEFGAGTPGAFGDVQASSTTGSDLLANTAIHLQRPEARNIHVPYTQAPSGF EFWKNNSGQPLSDTAPFGCKVNVNPLRADKCAVGSLPISVDIPDAAFTRVSEPLPSLLKC TVTSCTYSTDYGGVLVLTYESDRAGQCAVHSHSSTAVLRDPSVYVEQKGETTLKFSTRSL QADFEVSMCGTRTTCHAQCQPPTEHVMNRPQKSTPDFSSAISKTSWNWITALMGGISSIA AIAAIVLVIALVFTAQHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Aura virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | Q86925 |
◆ Recombinant Proteins | ||
GPR183-2661R | Recombinant Rat GPR183 Protein | +Inquiry |
KIT-396HAF555 | Recombinant Human KIT Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD40LG-680R | Recombinant Rhesus monkey CD40LG Protein, His-tagged | +Inquiry |
RFL520VF | Recombinant Full Length Variola Virus Hemagglutinin(Ha) Protein, His-Tagged | +Inquiry |
CERS3-3202H | Recombinant Human CERS3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
Trypsin-265H | Native Human Trypsin | +Inquiry |
F2-73R | Native Rat Prothrombin | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
Jurkat-010HCL | Human Jurkat Whole Cell Lysate | +Inquiry |
PIK3R1-3185HCL | Recombinant Human PIK3R1 293 Cell Lysate | +Inquiry |
SEPT6-1955HCL | Recombinant Human SEPT6 293 Cell Lysate | +Inquiry |
P4HA1-3483HCL | Recombinant Human P4HA1 293 Cell Lysate | +Inquiry |
BCS1L-167HCL | Recombinant Human BCS1L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Aura virus Structural polyprotein Products
Required fields are marked with *
My Review for All Aura virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket