Recombinant Full Length Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL25410PF |
Product Overview : | Recombinant Full Length ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q1XDF9) (1-628aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyropia yezoensis (Susabi-nori) (Porphyra yezoensis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-628) |
Form : | Lyophilized powder |
AA Sequence : | MKLSWKTLLLWSLPIFVIGFFFWQGFLGPTTTDVGSNIASSRMTYGRFLEYLDMGWVKRV DLYENNHTAIVEAVGPELGNRVQRIRVELPASAPELITKLRKANVDLDAHPPKSTSAVWG LLGNLLFPLLLVGGLAFLFRRSNNASGGPGQAMSFGKSKALFQMEAKTGVVFNDVAGVEE AKEEFQEVVTFLKQPESFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEASVPFFSISGS EFVEMFVGVGASRVRDLFKKAKDNAPCIVFIDEIDAVGRQRGTGVGGGNDEREQTLNQLL TEMDGFEGNTGVIVIAATNRADILDSALLRPGRFDRQVSVDVPDFKGRLAILEVHAKNKK MEPKVSLETIARRTPGFSGADLANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGT PLIDSKSKRLIAYHEVGHAIIGSLLEHHDPVQKVTLIPRGQARGLTWFTPSDDQSLISRS QILARIVGALGGRAAEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQ GGDPFLGRGMGGGSEYSDEVATNIDKQVREIVSECYAQAKHIIIDNRVVIDRLVDLLIEK ETIEGNEFRDIVKEYTAIPEKNYYISQF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | Q1XDF9 |
◆ Recombinant Proteins | ||
Nrxn1-3747R | Recombinant Rat Nrxn1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF207-4643H | Recombinant Human RNF207 protein, His&Myc-tagged | +Inquiry |
CD6-05H | Active Recombinant Human CD6 Protein, hIgG/His-tagged | +Inquiry |
WIPI2-1313C | Recombinant Chicken WIPI2 | +Inquiry |
CCDC129-1303M | Recombinant Mouse CCDC129 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-31M | Active Native Mouse Thrombin | +Inquiry |
CA2-31M | Native Mouse Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
APOH-4217H | Native Human APOH protein | +Inquiry |
LDL-245H | Native Human Lipoproteins, Low Density | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIAA1456-7946HCL | Recombinant Human C8orf79 293 Cell Lysate | +Inquiry |
HNMT-5455HCL | Recombinant Human HNMT 293 Cell Lysate | +Inquiry |
RBM12-2480HCL | Recombinant Human RBM12 293 Cell Lysate | +Inquiry |
TIFA-1078HCL | Recombinant Human TIFA 293 Cell Lysate | +Inquiry |
C9orf116-7942HCL | Recombinant Human C9orf116 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket