Recombinant Full Length Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL25891CF |
Product Overview : | Recombinant Full Length ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (O19922) (1-614aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanidium caldarium (Red alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-614) |
Form : | Lyophilized powder |
AA Sequence : | MKKQWKKIVLFVLPVIITLITLSSFLFYNQDVVHNWSSSRMTYGRFLEYIDMNWVKKVDL YDNARTAIVDIINPDIKGEEQLVRVELPTFSSELVSKLKNKLIDFDAHPSSSNVNLVSWL SNLLLPLILIITLFFFFRRGNKSSSGPGQAFNFGKAKARFHMEAKTGIVFEDVAGIEEAK EELQEIVAFLKDSRKFTNVGATIPKGVLLVGPPGTGKTLLAKAIAGEASAPFFSISGSEF VEMFVGVGASRVRDLFKKAKEKAPCIVFIDEIDAVGRQRGVGIGGGNDEREQTLNQLLTE MDGFSGDTGVIVVAATNRIDVLDSALLRPGRFDRQIMVSLPNINGRLAILKVHSKKKKIH KDVLLEVIARRTPGFSGADLANLLNEAAILTVRRGKVEITMKEIEDSIDKIIAGLEGSPL ADSRIKRLIAYHEAGHAVAATFLPHHDPVQKVTLIPRRQAKGLTWFLPNDDQFLVSKSQI LSKIIAALAGRAMEEIVFGLPEVTIGAANDIKQVTFMARQMVTKFGMSKVGPICLENSSS EVFIGRDLMGRHELSEEMVAKVDLEVRSILKDCYIQARTILSQNRKLIDRVVNELVEKET IEAKEFMRIVEERV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | O19922 |
◆ Recombinant Proteins | ||
CAD-1966Z | Recombinant Zebrafish CAD | +Inquiry |
NELL1-336HF | Recombinant Full Length Human NELL1 Protein | +Inquiry |
SCO4655-1140S | Recombinant Streptomyces coelicolor A3(2) SCO4655 protein, His-tagged | +Inquiry |
CHIA.4-10752Z | Recombinant Zebrafish CHIA.4 | +Inquiry |
RFL18587SF | Recombinant Full Length Schizosaccharomyces Pombe Translocation Protein Sec63(Sec63) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOH-4217H | Native Human APOH protein | +Inquiry |
GFAP-171B | Native bovine GFAP | +Inquiry |
Proteoglycans-50B | Native Bovine Proteoglycans | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYTL2-1300HCL | Recombinant Human SYTL2 293 Cell Lysate | +Inquiry |
ZNF26-2000HCL | Recombinant Human ZNF26 cell lysate | +Inquiry |
SERPINA1A-003MCL | Recombinant Mouse SERPINA1A cell lysate | +Inquiry |
TNFRSF1A-1084RCL | Recombinant Rat TNFRSF1A cell lysate | +Inquiry |
APCS-3089MCL | Recombinant Mouse APCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket