Recombinant Full Length Aspergillus Oryzae Gpi Mannosyltransferase 4(Smp3) Protein, His-Tagged
Cat.No. : | RFL34906AF |
Product Overview : | Recombinant Full Length Aspergillus oryzae GPI mannosyltransferase 4(smp3) Protein (Q2UTP0) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MWRRTYLLLLVIRVYFALSPSYLHPDENFQGPEVFAGRVLSYPSKLPWEFTADKPIRSVF PLWPIYDVPISLLKWFYAETGAPTPPPPQVIYYVLRGVMFLLGFVLEDWAVYELVPFARH RRATVVLVASSYVTWTYQTHTFSNSLETLLVAWGLVLIRRIVVNKRRSSVFSCAVLAFIA VAGVFNRITFPAFLAIPGLQLLPHFRRKSVSPPVSLFSFVGFGIFFFGIAVLVDTAFYRP SATLWDALHSPIITPINNLLYNSDSSNLALHGLHPHYQHFLVNLPQLLGPAYAMMAISLW GLPVIPTWLKNARAVSALSATVILSIFPHQEPRFLIPCVPLLLSCFRVSKSRLFLAVWMI FNAALGFLMGIYHQGGVVPAQLAMPSIISASSVESNDALPGEIPVVSATVFWWKTYSPPL WLLGTNDNSSLNIETRDLMGVPGPNLIEELEKLLPPCNVAGSKQAGSVFVVAPKSAAFLD RYTFLPSSSSVSSALELHELWSYRKHINLDDLDFGTEGVYPTLRRVIGRRGLAVWRAKRA GCN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | smp3 |
Synonyms | smp3; AO090009000654; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV |
UniProt ID | Q2UTP0 |
◆ Recombinant Proteins | ||
ATP2A1-969H | Recombinant Human ATP2A1 protein, GST-tagged | +Inquiry |
SLC14A1-8223M | Recombinant Mouse SLC14A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK2-523H | Recombinant Human PCSK2 Protein, His-tagged | +Inquiry |
HES5-1988C | Recombinant Chicken HES5 | +Inquiry |
NAGB-1085S | Recombinant Streptomyces coelicolor A3(2) NAGB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
NEFM-1520B | Native Bovine NEFM | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPZA3-280HCL | Recombinant Human CAPZA3 cell lysate | +Inquiry |
PIWIL3-1361HCL | Recombinant Human PIWIL3 cell lysate | +Inquiry |
LNCaP-995H | LNCaP (human prostate carcinoma) nuclear extract lysate | +Inquiry |
IMPDH1-5212HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
LEPREL4-1563HCL | Recombinant Human LEPREL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All smp3 Products
Required fields are marked with *
My Review for All smp3 Products
Required fields are marked with *
0
Inquiry Basket