Recombinant Full Length Ashbya Gossypii Spore Membrane Assembly Protein 2(Sma2) Protein, His-Tagged
Cat.No. : | RFL14715AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Spore membrane assembly protein 2(SMA2) Protein (Q756X9) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MGSRLLQFQSYGKWFMLLSLATAICLLHLPSYSCTYSRDLPICTPQVSFQLTNTTPTATL FLSTVKEVSMLLSYVAIDLGWNVNFPKPNDYDTSNLVNTFDPSNKYHVNLFGYCKWQPLS NKATWYCMDNPNGLDIISMIVRDLGAQLGVLSHTNTKILSDSLWILYRSIFDSFYKFVHD DDYRADKVASFLQSLQQGGPLPSVDQFKTVTLLLKCFEKLTNAIQVTELCSFALIIIAIA LATVACVMDILAAREEKHSATSDKLPKALFFKQITLKLSYAVVTCSLFYQIGMAVYFLAL FSIRYPYDYKVKVMTFNPDTGYWLSVLRFVMEFWFAVACYIGLSLSRRRPSKEVDDLDWK DEEQTPDSGETAICVSTRGSTRIQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMA2 |
Synonyms | SMA2; AER135W; Spore membrane assembly protein 2 |
UniProt ID | Q756X9 |
◆ Recombinant Proteins | ||
GADD45A-1993H | Recombinant Human GADD45A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC26A4-249H | Recombinant Human SLC26A4 Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL18224PF | Recombinant Full Length Pyrococcus Abyssi Protease Htpx Homolog(Htpx) Protein, His-Tagged | +Inquiry |
AOX1-694R | Recombinant Rat AOX1 Protein | +Inquiry |
ESR1-28402TH | Recombinant Human ESR1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
Pepsin-27H | Native Human Pepsin (PP) Protein | +Inquiry |
IgG Fc-07H | Native Human Immunoglobulin G Fc (IgG Fc) | +Inquiry |
Histone-53C | Native Calf Histone Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSS51-149HCL | Recombinant Human ZMYND17 293 Cell Lysate | +Inquiry |
AOC3-85HCL | Recombinant Human AOC3 cell lysate | +Inquiry |
TOE1-874HCL | Recombinant Human TOE1 293 Cell Lysate | +Inquiry |
C2orf43-8079HCL | Recombinant Human C2orf43 293 Cell Lysate | +Inquiry |
NOV-001CCL | Recombinant Cynomolgus NOV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SMA2 Products
Required fields are marked with *
My Review for All SMA2 Products
Required fields are marked with *
0
Inquiry Basket