Recombinant Full Length Artemia Salina Nadh-Ubiquinone Oxidoreductase Chain 4(Nd4) Protein, His-Tagged
Cat.No. : | RFL28921AF |
Product Overview : | Recombinant Full Length Artemia salina NADH-ubiquinone oxidoreductase chain 4(ND4) Protein (P19046) (1-71aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Artemia salina (Brine shrimp) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-71) |
Form : | Lyophilized powder |
AA Sequence : | LFVLLWLTFTTQSFILFYVFFECSLIPTIILILGWGYQPERLPASYYFLFYTLLSSLPLL FIIMLTRVFIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ND4 |
Synonyms | ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment |
UniProt ID | P19046 |
◆ Recombinant Proteins | ||
SLC37A2-2757H | Recombinant Human SLC37A2, GST-tagged | +Inquiry |
FAM26F-5584M | Recombinant Mouse FAM26F Protein | +Inquiry |
NI36-RS09300-0854S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS09300 protein, His-tagged | +Inquiry |
YPEL4-5242R | Recombinant Rhesus monkey YPEL4 Protein, His-tagged | +Inquiry |
AYP1020-RS09460-5960S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS09460 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
FSH-93P | Active Native Porcine FSH | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENO2-6598HCL | Recombinant Human ENO2 293 Cell Lysate | +Inquiry |
FAM78A-6349HCL | Recombinant Human FAM78A 293 Cell Lysate | +Inquiry |
KHDRBS1-896HCL | Recombinant Human KHDRBS1 cell lysate | +Inquiry |
MED29-1074HCL | Recombinant Human MED29 cell lysate | +Inquiry |
G6PC2-6081HCL | Recombinant Human G6PC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ND4 Products
Required fields are marked with *
My Review for All ND4 Products
Required fields are marked with *
0
Inquiry Basket