Recombinant Full Length Artemia Franciscana Nadh-Ubiquinone Oxidoreductase Chain 1(Nd1) Protein, His-Tagged
Cat.No. : | RFL11920AF |
Product Overview : | Recombinant Full Length Artemia franciscana NADH-ubiquinone oxidoreductase chain 1(ND1) Protein (Q37714) (1-298aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Artemia franciscana (Brine shrimp) (Artemia sanfranciscana) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-298) |
Form : | Lyophilized powder |
AA Sequence : | MIYFIFLQVVMVLVSVAFLTLLERKILGYIQLRKGPNKVGFLGILQPFSDGVKLFCKEVS LPLVSNFMPYLVAPVFSLFLSFFLWTLVPFISYGAKFNLSFLLVICAMSVSVYSIMVAGW SSNSKYSLLGSIRAGAQTISYEVSLIIIILSPLMLFKKLDLEGYLVKSSYVGWPLYLCLP LGLCWFTTILAETNRTPFDLAEGESELVSGFNTEYMGVGFALIMLSEYASILFMSLLFSV VFGSMSFLMFCLVVYSYLWSRGSYPRYRYDNLMHLCWKSLLPTSLMFLCFYWSLSQGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ND1 |
Synonyms | ND1; ND-1; NADH-ubiquinone oxidoreductase chain 1; NADH dehydrogenase subunit 1 |
UniProt ID | Q37714 |
◆ Native Proteins | ||
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
Lectin-1730P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2AK3-6673HCL | Recombinant Human EIF2AK3 293 Cell Lysate | +Inquiry |
SHOC2-1852HCL | Recombinant Human SHOC2 293 Cell Lysate | +Inquiry |
IK-343HCL | Recombinant Human IK lysate | +Inquiry |
ZNHIT2-2096HCL | Recombinant Human ZNHIT2 cell lysate | +Inquiry |
PLA2G6-3139HCL | Recombinant Human PLA2G6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ND1 Products
Required fields are marked with *
My Review for All ND1 Products
Required fields are marked with *
0
Inquiry Basket